Tested Applications
| Positive WB detected in | HeLa cells, L02 cells, MCF-7 cells, MDA-MB-231 cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human kidney tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14088-1-AP targets SREBF1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, bovine, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5219 Product name: Recombinant human SREBF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC063281 Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK Predict reactive species |
| Full Name | sterol regulatory element binding transcription factor 1 |
| Calculated Molecular Weight | 1177 aa, 125 kDa |
| Observed Molecular Weight | 125 kDa, 68 kDa |
| GenBank Accession Number | BC063281 |
| Gene Symbol | SREBF1 |
| Gene ID (NCBI) | 6720 |
| RRID | AB_2255217 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125 kDa precursor form and the 68 kDa mature form of human SREBF1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| IHC protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| IP protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| WB protocol for SREBF1 antibody 14088-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SREBF1 antibody (Cat# 14088-1-AP) has accumulated 401 citations in journals including Nature, Science, Cancer Cell, Cell Metabolism, Nature Communications, Cell Death & Differentiation, Hepatology, Redox Biology, Molecular Cell, Phytomedicine, Journal of Ethnopharmacology, and many others. Associated research fields encompass lipid metabolism, oncology, liver diseases (NAFLD/NASH/ALD), ferroptosis, diabetes, obesity, atherosclerosis, renal disease, neuroinflammation, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Midkine as a driver of age-related changes and increase in mammary tumorigenesis | ||
Cancer Cell KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy | ||
Science Liver ALKBH5 regulates glucose and lipid homeostasis independently through GCGR and mTORC1 signaling | ||
Reviews
What customers say
The single review for 14088-1-AP is a 5-star rating from May 2022. The user reported excellent performance across three applications: Western Blot at 1:1000 dilution, Immunofluorescence at 1:500 dilution, and ChIP at 3 µg/ml. Overall, the antibody was described as working perfectly for all tested applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Isha (Verified Customer) (05-18-2022) | Antibody worked perfect at 1:1000 dilution for W.B. and 1:500 for IF. And for chIP 3ug/ml worked best.
|
