Spartin/SPG20 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Spartin/SPG20 Polyclonal antibody (13791-1-AP)

• Featured Product
• KD/KO Validated

Spartin/SPG20 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 13791-1-AP

Publications(20)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Synonyms

SPG20, KIAA0610, SPART, Spartin, SPG 20

• 

  WB analysis using 13791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13791-1-AP (Spartin/SPG20 antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13791-1-AP

  WB result of Spartin, SPG20 antibody (13791-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Spartin, SPG20 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 13791-1-AP

  IP result of anti-Spartin, SPG20 (IP:13791-1-AP, 4ug; Detection:13791-1-AP 1:2000) with HeLa cells lysate 2320 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13791-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13791-1-AP (Spartin, SPG20 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13791-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13791-1-AP (Spartin, SPG20 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 13791-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13791-1-AP (Spartin, SPG20 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 13791-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug Anti-Human Spartin, SPG20 (13791-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, PANC-1 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13791-1-AP targets Spartin/SPG20 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4815

  Product name: Recombinant human Spartin, SPG20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC047083

  Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI

• Full Name: spastic paraplegia 20 (Troyer syndrome)
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75-84 kDa
• GenBank Accession Number: BC047083
• Gene Symbol: Spartin
• Gene ID (NCBI): 23111
• RRID: AB_2195683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0X7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Host Microbe; A CRISPR activation screen identifies SPART as a pan-orthoflavivirus restriction factor.; Authors - Qi Li
mouse,human	WB,IP,IHC,IF	Nat Cell Biol; The Troyer syndrome protein spartin mediates selective autophagy of lipid droplets; Authors - Jeeyun Chung
human	WB	Autophagy; Lipophagy fuels phosphatidylcholine synthesis for Newcastle disease virus replication.; Authors - Mengqing Yang
human	WB	Nat Commun; Spatial proteomics reveals secretory pathway disturbances caused by neuropathy-associated TECPR2; Authors - Karsten Nalbach
mouse,human	WB	Adv Sci (Weinh); Targeting Endogenous Lipophagy: A Novel Strategy to Enhance MSC Osteogenesis and Mineralization for Senile Osteoporosis Therapy.; Authors - Chaoqiang Chen ; KO Validated
		Proc Natl Acad Sci U S A; Spartin-mediated lipid transfer facilitates lipid droplet turnover; Authors - Neng Wan

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

beyenech (Verified Customer) (11-22-2019)

The antibody works also for Immunoprecipitation

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: IF: 1:100; WB:1:1000
• Cell Tissue Type: 293T and HeLa

Spartin/SPG20 Antibody Western Blot,Immunofluorescence, validation (IF: 1:100; WB:1:1000 dilution) in 293T and HeLa (Cat no:13791-1-AP)