• Featured Product
  • KD/KO Validated

SOX17 Polyclonal antibody

SOX17 Polyclonal Antibody for WB, ELISA
Cat No. 24903-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Transcription factor SOX-17, Transcription factor SOX 17

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, PC-3 cells, mouse embryo

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24903-1-AP targets SOX17 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19157

Product name: Recombinant human SOX17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-66 aa of BC111365

Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES

Predict reactive species
Full Name SRY (sex determining region Y)-box 17
Calculated Molecular Weight 414 aa, 44 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC111365
Gene Symbol SOX17
Gene ID (NCBI) 64321
RRIDAB_2879789
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H6I2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder/bile duct formation (PMID: 19913509).

Protocols

Product Specific Protocols
WB protocol for SOX17 antibody 24903-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Mater Today Bio

Nanofiber-microwell cell culture system for spatially patterned differentiation of pluripotent stem cells in 3D

Authors - Youyi Tai
mouseWB

Stem Cell Reports

Phosphorylation of Threonine343 Is Crucial for OCT4 Interaction with SOX2 in the Maintenance of Mouse Embryonic Stem Cell Pluripotency.

Authors - Xianmixinuer Abulaiti
mouseWB

Front Cell Dev Biol

ADNP Controls Gene Expression Through Local Chromatin Architecture by Association With BRG1 and CHD4.

Authors - XiaoYun Sun
humanIF

Stem Cell Res

Establishment of an arrhythmogenic right ventricular cardiomyopathy derived iPSC cell line (USFi004-A) carrying a heterozygous mutation in PKP2 (c.1799delA).

Authors - Jiajia Yang
humanIF

Stem Cell Res

Generation of a Friedreich's Ataxia patient-derived iPSC line USFi001-A.

Authors - Mariana Burgos Angulo
humanIF

Stem Cell Res

Generation of an iPSC cell line (USFi003-A) from a patient with dilated cardiomyopathy carrying a heterozygous mutation in LMNA (p.R541C).

Authors - Jiajia Yang
Loading...
||
New chat Able
正在加载,请稍候...