Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14025-1-AP targets SOCS3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5170 Product name: Recombinant human SOCS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species |
| Full Name | suppressor of cytokine signaling 3 |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC060858 |
| Gene Symbol | SOCS3 |
| Gene ID (NCBI) | 9021 |
| RRID | AB_10597854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14543 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The suppressor of cytokine signaling (SOCS) family proteins are negative feedback system that inhibits cytokine signal transduction. One of the SOCS family, SOCS3, also named CIS3 and SSI3, is involved in inhibition of JAK/STAT pathway which regulates IL-6 signaling in vivo. SOCS3 can be rapidly trigger by a number of factors including interleukins, IFN-gamma and TNF-alpha. Pathology such as inflammatory response, wound repair and obesity and so on have been linked to SOCS3. Observed MW of SOCS3 is from 22-30 kDa(PMID: 24827536,PMID: 26260587, PMID: 26797799), consistent with the result of Catalog#14025-1-AP.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SOCS3 antibody 14025-1-AP | Download protocol |
| IP protocol for SOCS3 antibody 14025-1-AP | Download protocol |
| WB protocol for SOCS3 antibody 14025-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-SOCS3 antibody (Cat# 14025-1-AP) has accumulated 97 citations published in journals such as Nature Communications, Journal of Clinical Investigation, Cell Reports, Oncogene, PNAS, Kidney International, and FASEB Journal. Associated research fields include oncology (lung, liver, glioblastoma, breast, and ovarian cancers), immunology and inflammation (macrophage polarization, JAK/STAT signaling), neuroscience (spinal cord injury, Alzheimer's disease), metabolism (insulin resistance, obesity), infectious diseases (viral pathogenesis), nephrology, and cardiovascular biology.
| Species | Application | Title |
|---|---|---|
Kidney Int Ablation of proximal tubular suppressor of cytokine signaling 3 enhances tubular cell cycling and modifies macrophage phenotype during acute kidney injury. | ||
Nat Commun Cullin-5 deficiency promotes chimeric antigen receptor T cell effector functions potentially via the modulation of JAK/STAT signaling pathway | ||
J Adv Res Endogenous hydrogen sulfide improves vascular remodeling through PPARδ/SOCS3 signaling. | ||
Redox Biol TNFα counteracts interleukin-10 anti-inflammatory pathway through the NOX2-Lyn-SHP-1 axis in human monocytes | ||
J Nanobiotechnology NAMPT encapsulated by extracellular vesicles from young adipose-derived mesenchymal stem cells treated tendinopathy in a "One-Stone-Two-Birds" manner | ||
J Clin Invest Cullin5 deficiency promotes small-cell lung cancer metastasis by stabilizing integrin β1.
|
