SLC25A46 Polyclonal antibody

• 

  WB analysis using 12277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12277-1-AP

  WB result of SLC25A46 antibody (12277-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells.

• 

  WB analysis of Jurkat using 12277-1-AP

  WB result of SLC25A46 antibody (12277-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells.

• 

  WB analysis using 12277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SLC25A46 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12277-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Mitochondrial outer membrane protein SLC25A46, TB1

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue, MCF-7 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 9 publications below
• IF: See 1 publications below

Product Information

12277-1-AP targets SLC25A46 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2923

  Product name: Recombinant human SLC25A46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC017169

  Sequence: MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSL

• Full Name: solute carrier family 25, member 46
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017169
• Gene Symbol: SLC25A46
• Gene ID (NCBI): 91137
• RRID: AB_2239384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; A High-Density Human Mitochondrial Proximity Interaction Network.; Authors - Hana Antonicka
	WB	Sci Adv; Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1.; Authors - Odetta Antico
human	WB,IF	Brain; Loss of function of SLC25A46 causes lethal congenital pontocerebellar hypoplasia.; Authors - Jijun Wan
human	WB	EMBO Mol Med; SLC25A46 is required for mitochondrial lipid homeostasis and cristae maintenance and is responsible for Leigh syndrome.; Authors - Alexandre Janer ; KD Validated
human	WB	J Pers Med; Reanalysis of Exome Data Identifies Novel SLC25A46 Variants Associated with Leigh Syndrome.; Authors - Qifei Li
human	WB	Mol Biol Cell; Rapid degradation of mutant SLC25A46 by the ubiquitin-proteasome system results in MFN1/2 mediated hyperfusion of mitochondria.; Authors - Janos Steffen ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xianhe (Verified Customer) (07-15-2022)

The WB band is clean and clear, the binding affinity is strong and specific.

• Applications: Western Blot