SLC25A46 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A46 Polyclonal antibody (12277-1-AP)

• Featured Product
• KD/KO Validated

SLC25A46 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12277-1-AP Copied!

Publications (11)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Mitochondrial outer membrane protein SLC25A46, TB1

• 

  WB analysis using 12277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12277-1-AP

  WB result of SLC25A46 antibody (12277-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12277-1-AP

  WB result of SLC25A46 antibody (12277-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC25A46 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12277-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12277-1-AP (SLC25A46 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 12277-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 12277-1-AP (SLC25A46 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 12277-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SLC25A46 antibody (12277-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Jurkat using 12277-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using SLC25A46 antibody (12277-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A46 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue, MCF-7 cells
• Positive IHC detected in: human stomach tissue, mouse colon tissue, human rectal cancer tissue, rat lung tissue, human appendicitis tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12277-1-AP targets SLC25A46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2923

  Product name: Recombinant human SLC25A46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC017169

  Sequence: MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPCIVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECVKEGIGRVIGMGVPHSKRLLPLLSL

• Full Name: solute carrier family 25, member 46
• Calculated Molecular Weight: 418 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC017169
• Gene Symbol: SLC25A46
• Gene ID (NCBI): 91137
• RRID: AB_2239384
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.

Publications

What published studies show

Anti-SLC25A46 (Mic19) Rabbit mAb, Cat# 12277-1-AP has 11 citations across journals including Cell Metabolism, Nature Communications, Science Advances, Brain, EMBO Molecular Medicine, Journal of Cell Science, Molecular Biology of the Cell, Journal of Personalized Medicine, and bioRxiv. Research fields span mitochondrial biology, lipid metabolism, mitophagy (PINK1-Parkin pathway), mitochondrial fission/fusion dynamics, cristae maintenance, and neurodegenerative diseases (Leigh syndrome, pontocerebellar hypoplasia).

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; A High-Density Human Mitochondrial Proximity Interaction Network.; Authors - Hana Antonicka
mouse,human	WB	Nat Commun; Mic19 depletion impairs endoplasmic reticulum-mitochondrial contacts and mitochondrial lipid metabolism and triggers liver disease; Authors - Jun Dong ; KD Validated
human	WB	Sci Adv; Structural evolution of the MTCH family of mitochondrial insertases.; Authors - Taylor A. Stevens
	WB	Sci Adv; Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1.; Authors - Odetta Antico
human	WB,IF	Brain; Loss of function of SLC25A46 causes lethal congenital pontocerebellar hypoplasia.; Authors - Jijun Wan
human	WB	EMBO Mol Med; SLC25A46 is required for mitochondrial lipid homeostasis and cristae maintenance and is responsible for Leigh syndrome.; Authors - Alexandre Janer ; KD Validated

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One customer (Li, 2022) rated this product 5 stars for Western Blot, noting that the band is clean and clear with strong and specific binding affinity. Overall, the single review reflects a very positive experience with the antibody's performance in WB applications.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Xianhe (Verified Customer) (07-15-2022)

The WB band is clean and clear, the binding affinity is strong and specific.

• Applications: Western Blot