SLC22A15 Polyclonal antibody

• 

  WB analysis of HEK-293 using 20626-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 20626-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 20626-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 20626-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 20626-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 20626-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 20626-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 20626-1-AP (SLC22A15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

SLC22A15 Polyclonal Antibody for WB, ELISA

Cat No. 20626-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Flipt 1, FLIPT1, Fly-like putative transporter 1, PRO34686, UNQ9429/PRO34686

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A431 cells, human brain tissue, human heart tissue, human placenta tissue, human skeletal muscle tissue, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20626-1-AP targets SLC22A15 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14547

  Product name: Recombinant human SLC22A15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 431-535 aa of BC026358

  Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK

• Full Name: solute carrier family 22, member 15
• Calculated Molecular Weight: 535aa,59 kDa; 547aa,61 kDa
• Observed Molecular Weight: 61-66 kDa
• GenBank Accession Number: BC026358
• Gene Symbol: SLC22A15
• Gene ID (NCBI): 55356
• RRID: AB_10693537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZD6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.