SIRT5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SIRT5 Polyclonal antibody (15122-1-AP)

• Featured Product
• KD/KO Validated

SIRT5 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 15122-1-AP Copied!

Publications (75)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

EC:2.3.1.-, NAD-dependent protein deacylase sirtuin-5, mitochondrial, Regulatory protein SIR2 homolog 5, SIR2L5, SIR2-like protein 5

• 

  WB analysis using 15122-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15122-1-AP (SIRT5 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 15122-1-AP

  IP result of anti-SIRT5 (IP:15122-1-AP, 4ug; Detection:15122-1-AP 1:500) with mouse liver tissue lysate 6000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15122-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SIRT5 antibody (15122-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SIRT5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, RAW 264.7 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15122-1-AP targets SIRT5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7195

  Product name: Recombinant human SIRT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-310 aa of BC000126

  Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

• Full Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000126
• Gene Symbol: SIRT5
• Gene ID (NCBI): 23408
• RRID: AB_2188778
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXA8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in cytoplasm. It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels.

Publications

What published studies show

The SIRT5 antibody (Cat# 15122-1-AP) has accumulated 75 citations published in high-impact journals including Cell Metabolism, Nature Metabolism, Nature Communications, Molecular Cell, Science Translational Medicine, Cell Death & Differentiation, Free Radical Biology and Medicine, and EBioMedicine. Associated research fields encompass post-translational modifications (succinylation, acetylation, lactylation, malonylation), mitochondrial biology, oncology, neurodegeneration, diabetic kidney disease, cardiovascular disease, inflammation, and ferroptosis.

Automatically generated from the 75 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Metab; Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation; Authors - Jian Zhou
mouse	WB	Cell Metab; Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.; Authors - Yi Fu
human	WB	Nat Metab; Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis.; Authors - Shi-Ting Li
mouse	WB	Nat Commun; Sirt6 deficiency exacerbates podocyte injury and proteinuria through targeting Notch signaling.; Authors - Min Liu
rat	WB,IF,CoIP	Exp Mol Med; SIRT5-related desuccinylation modification of AIFM1 protects against compression-induced intervertebral disc degeneration by regulating mitochondrial homeostasis; Authors - Jianxin Mao ; KD Validated
mouse	WB	Mol Cell; Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation; Authors - Chuanlong Wang