• Featured Product
  • KD/KO Validated

SIRT1 Recombinant monoclonal antibody

SIRT1 Uni-rAb® Recombinant Antibody for WB, IHC-Autostainer, IF/ICC, IP, ELISA
Cat No. 82790-4-RR
Clone No.2F11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC-Autostainer, IF/ICC, IP, ELISA

2F11, EC:2.3.1.-, EC:2.3.1.286, hSIR2, hSIRT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, MCF-7 cells, Jurkat cells, K-562 cells
Positive IP detected inHEK-293 cells
Positive IHC-Autostainer detected inhuman testis tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82790-4-RR targets SIRT1 in WB, IHC-Autostainer, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3808

Product name: Recombinant human SIRT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC012499

Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Calculated Molecular Weight 747 aa, 82 kDa
Observed Molecular Weight110-130 kDa
GenBank Accession NumberBC012499
Gene Symbol SIRT1
Gene ID (NCBI) 23411
RRIDAB_3086537
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96EB6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SirT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SirT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin, and inner membrane. It can shuttles between the nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition, SIRT1 activation elicits resistance to oxidative stress via the regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382.

Protocols

Product Specific Protocols
IF protocol for SIRT1 antibody 82790-4-RRDownload protocol
IP protocol for SIRT1 antibody 82790-4-RRDownload protocol
WB protocol for SIRT1 antibody 82790-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...