SIN3A Polyclonal antibody

• 

  WB analysis of Jurkat using 14638-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14638-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 14638-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 14638-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14638-1-AP (SIN3A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 14638-1-AP

  IP result of anti-SIN3A (IP:14638-1-AP, 4ug; Detection:14638-1-AP 1:500) with Jurkat cells lysate 3600ug.

• 

  IF Staining of HepG2 using 14638-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SIN3A antibody (14638-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

SIN3A Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14638-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

KIAA0700

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells, K-562 cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

14638-1-AP targets SIN3A in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6219

  Product name: Recombinant human SIN3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC066364

  Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY

• Full Name: SIN3 homolog A, transcription regulator (yeast)
• Calculated Molecular Weight: 145 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC066364
• Gene Symbol: SIN3A
• Gene ID (NCBI): 25942
• RRID: AB_2301741
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96ST3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Theranostics; SLC14A1 prevents oncometabolite accumulation and recruits HDAC1 to transrepress oncometabolite genes in urothelial carcinoma.; Authors - Ti-Chun Chan
human	WB,CoIP	Int J Biol Sci; TET1s deficiency exacerbates oscillatory shear flow-induced atherosclerosis.; Authors - Kai Qu
		Cell Rep; ZNF451 favors triple-negative breast cancer progression by enhancing SLUG-mediated CCL5 transcriptional expression; Authors - Yu Zhang
mouse	WB,IP	Nat Commun; Glucocorticoids increase adiposity by stimulating Krüppel-like factor 9 expression in macrophages; Authors - Yinliang Zhang
rat	WB	Bioact Mater; Chitosan/PLGA-based tissue engineered nerve grafts with SKP-SC-EVs enhance sciatic nerve regeneration in dogs through miR-30b-5p-mediated regulation of axon growth; Authors - Miaomei Yu