Surfactant protein D Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Surfactant protein D Polyclonal antibody (11839-1-AP)

Surfactant protein D Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 11839-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

SFTPD, COLEC7, Collectin 7, Collectin-7, Lung surfactant protein D

• 

  WB analysis using 11839-1-AP

  Mouse lung tissue was subjected to SDS PAGE followed by western blot with 11839-1-AP (Surfactant protein D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 11839-1-AP

  IP result of anti-Surfactant protein D (IP:11839-1-AP, 3ug; Detection:11839-1-AP 1:300) with mouse lung tissue lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 11839-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11839-1-AP (Surfactant protein D antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 11839-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11839-1-AP (Surfactant protein D antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 11839-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using Surfactant protein D antibody (11839-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 11839-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using Surfactant protein D antibody (11839-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Surfactant protein D in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11839-1-AP targets Surfactant protein D in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2461

  Product name: Recombinant human SFTPD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-375 aa of BC022318

  Sequence: AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

• Full Name: surfactant protein D
• Calculated Molecular Weight: 375 aa, 38 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC022318
• Gene Symbol: Surfactant protein D
• Gene ID (NCBI): 6441
• RRID: AB_2254351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35247
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Surfactant protein-D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.

Publications

What published studies show

The Surfactant protein D (SP-D) polyclonal antibody (Cat# 11839-1-AP) has 8 total citations spanning journals including Environmental Pollution, International Journal of Molecular Sciences, BMC Cancer, International Journal of Chronic Obstructive Pulmonary Disease, Cell Biochemistry and Function, Human Cell, Journal of Thoracic Disease, and Translational Pediatrics. The research fields center on pulmonary biology, covering acute lung injury, lung development, bronchopulmonary dysplasia, ventilator-induced lung injury, and alveolar epithelial cell function in mouse, rat, and human models.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Environ Pollut; LRRK2 is involved in heat exposure-induced acute lung injury and alveolar type II epithelial cell dysfunction; Authors - Yindan Wang
mouse	WB	Int J Mol Sci; Kub3 Deficiency Causes Aberrant Late Embryonic Lung Development in Mice by the FGF Signaling Pathway.; Authors - Guangying Yang
mouse	WB	BMC Cancer; Identification of hub genes and pathways in lung metastatic colorectal cancer; Authors - Wei Dai
rat	WB,IF	Int J Chron Obstruct Pulmon Dis; Effective-Component Compatibility of Bufei Yishen Formula III Protects Lung Air-Blood Barrier by Regulating the Oxidative Stress: via the Nuclear Factor-E2-Related Factor 2 Pathway; Authors - Kexin Xu
mouse	IF	Cell Biochem Funct; IL-37 Protects Against Ventilator-Induced Lung Injury by Inhibiting NLRP3 Activation; Authors - Xingmeng Xu
human	WB,IF	Hum Cell; Aryl hydrocarbon receptor promotes lipid droplet biogenesis and metabolic shift in respiratory Club cells.; Authors - Hsueh-Chun Wang