Tested Applications
| Positive WB detected in | HL-60 cells, MCF-7 cells, THP-1 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human breast cancer tissue, human liver cancer tissue, human oesophagus cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | HeLa cells, A549 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26992-1-AP targets S100A9 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species |
| Full Name | S100 calcium binding protein A9 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC047681 |
| Gene Symbol | S100A9 |
| Gene ID (NCBI) | 6280 |
| RRID | AB_2880716 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06702 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner(S100A8/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A9 antibody 26992-1-AP | Download protocol |
| IHC protocol for S100A9 antibody 26992-1-AP | Download protocol |
| IP protocol for S100A9 antibody 26992-1-AP | Download protocol |
| WB protocol for S100A9 antibody 26992-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The S100A9 antibody (Cat# 26992-1-AP) has accumulated 106 citations across over 70 journals, including Nature Communications, Cell Research, Nature Biomedical Engineering, Science Advances, Cell Host & Microbe, and Theranostics. Research fields span immunology and inflammation, oncology, cardiology, neurology, pulmonology, dermatology, gastroenterology, proteomics, infectious disease, diabetes, ophthalmology, and reproductive medicine. Key applications include WB, IHC, IF, IP, and CoIP, primarily in human and rodent models.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Thromboxane receptor activation in dendritic cells mitigates sepsis by suppressing S100a8/a9-mediated neutrophil recruitment | ||
Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. | ||
Cell Host Microbe A gut-secreted histidine methyltransferase enforces cross-kingdom catalytic antifungal defense. | ||
Bone Res Human peripheral osteoclast-precursor-development patterns reveal the significance of RPS17-dependent ribosome synthesis to Ankylosing Spondylitis lesions. | ||
Nat Commun Senescent immune cells accumulation promotes brown adipose tissue dysfunction during aging |
Reviews
What customers say
One reviewer (Christelle S.) rated this product 3/5 stars in a Western Blot application at 1:1000 dilution on platelet lysate (lot 00040992). The reviewer reported observing too many non-specific bands, suggesting the antibody may benefit from optimization of dilution or blocking conditions to improve specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christelle (Verified Customer) (04-23-2026) | I found too many bands non specific
 |
