S100A12 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human tonsillitis using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 16630-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16630-1-AP (S100A12 Antibody) at dilution of 1:200 (under 40x lens).

S100A12 Polyclonal Antibody for IHC, ELISA

Cat No. 16630-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CAAF1, CAGC, Calgranulin C, CGRP, EN RAGE, ENRAGE, MRP6, Neutrophil S100 protein, p6, Protein S100 A12, S100A12

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 3 publications below

Product Information

16630-1-AP targets S100A12 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9961

  Product name: Recombinant human S100A12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC070294

  Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

• Full Name: S100 calcium binding protein A12
• Calculated Molecular Weight: 92 aa, 11 kDa
• GenBank Accession Number: BC070294
• Gene Symbol: S100A12
• Gene ID (NCBI): 6283
• RRID: AB_2878290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P80511
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A12 is expressed abundantly in granulocytes, and has been implicated to play an important role on inflammatory reactions in various disease states.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Biol Reprod; Effects of progesterone and interferon tau on ovine endometrial phosphate, calcium, and vitamin D signaling.; Authors - Claire Stenhouse
human	WB,IHC	Connect Tissue Res; S100A12 is involved in the pathology of osteoarthritis by promoting M1 macrophage polarization via the NF-κB pathway; Authors - Yi Zhang
human	IHC	Redox Biol; Lipoxin A4 ameliorates knee osteoarthritis progression in rats by antagonizing ferroptosis through activation of the ESR2/LPAR3/Nrf2 axis in synovial fibroblast-like synoviocytes; Authors - Zhehan Hu
	WB	Animals (Basel); Comparative Study on the Sperm Proteomes of Horses and Donkeys; Authors - Hong Ren
human	WB	Front Immunol; Identification and validation of neutrophil-related biomarkers in acute-on-chronic liver failure; Authors - Wei Lin