RYR1 Polyclonal antibody

• 

  IHC staining of mouse brain using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skeletal muscle using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human cerebellum using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human cerebellum using 26968-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 26968-1-AP (RYR1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of mouse cerebellum using 26968-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using RYR1 antibody (26968-1-AP) at dilution of 1:200 and CoraLite®647-conjugated F(ab.

• 

  IF Staining of mouse brain using 26968-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using RYR1 antibody (26968-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

RYR1 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 26968-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CCO, MHS, MHS1, Ryanodine receptor 1, RYDR, RYR, RYR 1, RYR1, RYR1/2/3, SKRR

---

Tested Applications

• Positive IHC detected in: mouse brain tissue, human cerebellum tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

26968-1-AP targets RYR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25120

  Product name: Recombinant human RYR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4942-5038 aa of NM_000540

  Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS

• Full Name: ryanodine receptor 1 (skeletal)
• Calculated Molecular Weight: 565 kDa
• GenBank Accession Number: NM_000540
• Gene Symbol: RYR1
• Gene ID (NCBI): 6261
• RRID: AB_2880703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ryanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	JCI Insight; Muscle specific ER-associated degradation maintains postnatal muscle hypertrophy and systemic energy metabolism; Authors - Benedict Abdon
chicken	WB	Poult Sci; Effects of chronic heat stress on Ca2+ homeostasis, apoptosis, and protein carbonylation profiles in the breast muscle of broilers; Authors - Yingsen Liu