RPA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPA3 Polyclonal antibody (10692-1-AP)

RPA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10692-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

REPA3, Replication factor A protein 3, replication protein A3, 14kDa, RF A protein 3, RF-A protein 3

• 

  WB analysis using 10692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10692-1-AP (RPA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10692-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10692-1-AP (RPA3 antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 10692-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10692-1-AP (RPA3 antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, Jurkat cells, A549 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:750-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10692-1-AP targets RPA3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1065

  Product name: Recombinant human RPA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-121 aa of BC005264

  Sequence: MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD

• Full Name: replication protein A3, 14kDa
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005264
• Gene Symbol: RPA3
• Gene ID (NCBI): 6119
• RRID: AB_2269682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RPA3 Polyclonal antibody (Cat# 10692-1-AP) has 3 citations. These publications appear in Drug Resistance Updates, International Journal of Molecular Sciences, and Journal of Cell Science. The research fields span cancer drug resistance (specifically genotoxic drug resistance mediated by CSDE1-RPA2 interactions), breast cancer prognosis and drug sensitivity prediction via gene signatures, and cytokinetic abscission involving ESCRT-III dynamics.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Drug Resist Updat; CSDE1 enhances genotoxic drug resistance in cancer by modulating RPA2 through CSDE1-eIF3a regulatory complex; Authors - Jia-Jia Cui
human	WB	Int J Mol Sci; Construction of a Lysine Lactylation- and DNA Damage Repair-Related Gene Signature to Predict the Prognosis and Drug Sensitivity of Breast Cancer Patients.; Authors - Liang Zhu ; KD Validated
human	WB	J Cell Sci; UMAD1 contributes to ESCRT-III dynamic subunit turnover during cytokinetic abscission; Authors - James Glover