Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RICTOR Polyclonal antibody

RICTOR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

AVO3 homolog, hAVO3, KIAA1999, Rapamycin-insensitive companion of mTOR

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RICTOR in ?

Tested Applications

Positive WB detected inHEK-293 cells, NIH/3T3 cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman lung cancer tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27248-1-AP targets RICTOR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25649

Product name: Recombinant human RICTOR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-51 aa of BC029608

Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV

Predict reactive species
Full Name rapamycin-insensitive companion of mTOR
Calculated Molecular Weight 192 kDa
Observed Molecular Weight 192 kDa
GenBank Accession NumberBC029608
Gene Symbol RICTOR
Gene ID (NCBI) 253260
RRIDAB_2880817
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6R327
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RICTOR, is a key component of the mTOR complex 2 (mTORC2) and is required for phosphorylation of Akt at serine 473. RICTOR is the upstream kinase of several AGC kinase family members including AKT, SGK, S6K mutants and several PKC isoforms. Activation of RICTOR-mTORC2 modifies actin organization and promotes cell proliferation and survival. Rictor is overexpressed in several cancers leading to hyperactive mTORC2 and has been shown to play a causal role in glioma formation. Rictor expression has been demonstrated to be regulated transcriptionally and via protein degradation.

Protocols

Product Specific Protocols
IF protocol for RICTOR antibody 27248-1-APDownload protocol
IHC protocol for RICTOR antibody 27248-1-APDownload protocol
WB protocol for RICTOR antibody 27248-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RICTOR Polyclonal antibody (Cat# 27248-1-AP) has 35 citations across journals including Nature Metabolism, Nature Neuroscience, Nature Communications, Cell Reports, Oncogene, and eLife. Research fields span mTORC2/Akt signaling, oncology (breast, colorectal, gastric, and liver cancers), neuroscience, cardiology, nephrology, immunology, developmental biology, and toxicology. Cited applications include WB, IHC, IF, and IP in human, mouse, and rat samples.

SpeciesApplicationTitle
mouseWB,IHC,IF

Nat Metab

Metabolic regulation by tanycyte-derived extracellular vesicles through insulin precursor-mediated neuronal recognition and mTORC component delivery.

Authors - Yuna Choi
mouseWB

Nat Neurosci

A glycolytic shift in Schwann cells supports injured axons.

Authors - Elisabetta Babetto
humanWB

Nat Commun

The UFL1-AKT positive feedback loop promotes breast cancer progression by enhancing lipid synthesis.

Authors - Fei Meng
humanWB

Nat Commun

The p300/YY1/miR-500a-5p/HDAC2 signalling axis regulates cell proliferation in human colorectal cancer.

Authors - Weimei Tang
mouse

Genes Dis

BMP9 induces osteogenic differentiation through up-regulating LGR4 via the mTORC1/Stat3 pathway in mesenchymal stem cells

Authors - Jie Zhang
humanWB

Cell Commun Signal

Rapamycin promotes endothelial-mesenchymal transition during stress-induced premature senescence through the activation of autophagy.

Authors - Norihiko Sasaki

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (5/5 stars) used this antibody for Western Blot on MDCK GII cells at a 1:1,000 dilution. They confirmed it recognizes RICTOR (~200 kD) as the top band. In cell lysates, some non-specific binding to other proteins was observed, but when testing eluted membrane-proximal proteins, RICTOR was detected cleanly with good specificity.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Joleen (Verified Customer) (06-12-2019)

The antibody recognizes RICTOR which is around ~200kD. It is the top most band. The first two lanes were cell lysates and show that the antibody recognizes other proteins non-specifically. The last lane contained eluted proteins that are presumably proximal to the cell membrane. RICTOR shows up there cleanly.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1k
  • Cell Tissue Type: MDCK GII
RICTOR Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:27248-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...