RBM15B Polyclonal antibody

• 

  WB analysis of HeLa using 22249-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 22249-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 22249-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 22249-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22249-1-AP (RBM15B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 22249-1-AP

  IP result of anti-RBM15B (IP:22249-1-AP, 4ug; Detection:22249-1-AP 1:500) with HeLa cells lysate 2500ug.

• Featured Product
• KD/KO Validated

RBM15B Polyclonal Antibody for WB, IP, ELISA

Cat No. 22249-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, RIP, ELISA

Synonyms

HUMAGCGB, HuOTT3, One twenty two protein 3, OTT3, RBM15B, RNA binding motif protein 15B

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• IHC: See 4 publications below
• CoIP: See 1 publications below
• RIP: See 2 publications below

Product Information

22249-1-AP targets RBM15B in WB, IHC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17744

  Product name: Recombinant human RBM15B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 490-769 aa of BC001367

  Sequence: AKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRL

• Full Name: RNA binding motif protein 15B
• Calculated Molecular Weight: 890 aa, 97 kDa
• Observed Molecular Weight: 100-120 kDa, 70 kDa
• GenBank Accession Number: BC001367
• Gene Symbol: RBM15B
• Gene ID (NCBI): 29890
• RRID: AB_2879048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NDT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM15B, one members of the SPEN (Split-end) family of proteins, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components. Present polyclonal anti-RBM15B antibody was produced by immunizing animals with C-terminus of RBM15B, which homolog with a short form of RBM15B(563aa, ~70kDa), thus this antibody can recognize full length of RBM15B(~100kDa) and splice-one(70kDa)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu ; KO Validated
human	WB	Mol Cell; mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis.; Authors - Elodie Villa
human	RIP	Elife; SNORD90 induces glutamatergic signaling following treatment with monoaminergic antidepressants; Authors - Rixing Lin
mouse	WB	Mol Neurobiol; GPR30 Inhibits Neuronal Apoptosis After Subarachnoid Hemorrhage by Activating the Wnt/β-Catenin Pathway in a m6A-dependent Manner; Authors - Jun Peng
human	WB	eNeuro; Altered Expression of the m6A Methyltransferase METTL3 in Alzheimer's Disease.; Authors - He Huang
human	IHC	Front Genet; m6A Regulatory Gene-Mediated Methylation Modification in Glioma Survival Prediction.; Authors - Guiyun Zhang