RB1 Polyclonal antibody

• 

  WB analysis of Jurkat using 25628-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25628-1-AP (RB1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 25628-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25628-1-AP (RB1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 25628-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25628-1-AP (RB1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 25628-1-AP

  IP result of anti-RB1 (IP:25628-1-AP, 4ug; Detection:25628-1-AP 1:300) with Jurkat cells lysate 3400ug.

• 

  IF Staining of HepG2 using 25628-1-AP

  Immunofluorescent analysis of HepG2 cells using 25628-1-AP (RB1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

RB1 Polyclonal Antibody for WB, IP, IF, ELISA

Cat No. 25628-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IF, ELISA

Synonyms

OSRC, p105 Rb, pp110, pRb, RB, RB1, retinoblastoma 1

---

Tested Applications

• Positive WB detected in: Jurkat cells, A431 cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

25628-1-AP targets RB1 in WB, IP, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22578

  Product name: Recombinant human RB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 373-581 aa of BC039060

  Sequence: TPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREG

• Full Name: retinoblastoma 1
• Calculated Molecular Weight: 928 aa, 106 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC039060
• Gene Symbol: RB1
• Gene ID (NCBI): 5925
• RRID: AB_2880168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06400
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Artif Cells Nanomed Biotechnol; Ribociclib (LEE011) suppresses cell proliferation and induces apoptosis of MDA-MB-231 by inhibiting CDK4/6-cyclin D-Rb-E2F pathway.; Authors - Tianqi Li
human	WB	Oncol Rep; Actin-capping protein CapG is associated with prognosis, proliferation and metastasis in human glioma.; Authors - Da-Peng Yun
human	IF	Oncol Lett; 14-3-3ε is a nuclear matrix protein, and its altered expression and localization are associated with curcumin-induced apoptosis of MG-63 cells.; Authors - Kun Lu
human	WB	Cell Death Dis; MCPIP1-mediated NFIC alternative splicing inhibits proliferation of triple-negative breast cancer via cyclin D1-Rb-E2F1 axis.; Authors - Fengxia Chen
human	WB	Biomed Pharmacother; Ribociclib, a selective cyclin D kinase 4/6 inhibitor, inhibits proliferation and induces apoptosis of human cervical cancer in vitro and in vivo.; Authors - Yudi Xiong