RAE1 Polyclonal antibody

• 

  WB analysis of BxPC-3 using 20491-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 20491-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 20491-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20491-1-AP (RAE1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 20491-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20491-1-AP (RAE1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human testis using 20491-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20491-1-AP (RAE1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of HepG2 using 20491-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RAE1 antibody (20491-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

RAE1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20491-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRNP41, mRNA-associated protein mrnp 41, mRNA export factor RAE1, mRNA export factor, Mnrp41

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HEK-293 cells, HepG2 cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

20491-1-AP targets RAE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12102

  Product name: Recombinant human RAE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC103754

  Sequence: MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

• Full Name: RAE1 RNA export 1 homolog (S. pombe)
• Calculated Molecular Weight: 368 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC103754
• Gene Symbol: RAE1
• Gene ID (NCBI): 8480
• RRID: AB_2878693
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P78406
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAE1 acts as a mRNA export factor involved in nucleocytoplasmic transport, it plays a role in mitotic bipolar spindle formation. (PMID: 33849972, MID: 17172455)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Dev Cell; Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination; Authors - Li Li
human	WB，IHC	Cancer Sci; Mitotic checkpoint regulator RAE1 promotes tumor growth in colorectal cancer.; Authors - Yuta Kobayashi
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu
human	IHC	Arch Biochem Biophys; RAE1 promotes gastric carcinogenesis and epithelial-mesenchymal transition; Authors - Wenhui Dong