RAC1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RAC1 Monoclonal antibody (66122-1-Ig)

• Featured Product
• KD/KO Validated

RAC1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 66122-1-Ig Copied!

Clone No. 4A4B11

Publications (62)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA

Synonyms

MIG5, p21 Rac1, RAC1, RAC1b, Ras like protein TC25, TC 25, TC25

• 

  WB analysis using 66122-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66122-1-Ig (Rac1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66122-1-Ig

  WB result of RAC1 antibody (66122-1-Ig, 1:2000) with si-control and si-RAC1 transfected NIH3T3 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 66122-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66122-1-Ig (RAC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66122-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66122-1-Ig (Rac1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HL-60 using 66122-1-Ig

  IP result of anti-RAC1 (IP:66122-1-Ig, 3ug; Detection:66122-1-Ig 1:700) with HL-60 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66122-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66122-1-Ig (RAC1 Antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66122-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66122-1-Ig (RAC1 Antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 66122-1-Ig

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed NIH/3T3 cells using 66122-1-Ig(Rac1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66122-1-Ig

  Immunofluorescent analysis of (10% Formaldehyde ) fixed HeLa cells using 66122-1-Ig(Rac1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human brain tissue, NIH/3T3 cells, HeLa cells, HUVEC cells, HL-60 cells, HSC-T6 cells, RAW 264.7 cells
• Positive IP detected in: HL-60 cells, HSC-T6 cells, Raw 264.7 cells, HUVEC cells, HL-60 cells, NIH/3T3 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66122-1-Ig targets RAC1 in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17779

  Product name: Recombinant human RAC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-192 aa of BC004247

  Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

• Full Name: ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC004247
• Gene Symbol: RAC1
• Gene ID (NCBI): 5879
• RRID: AB_2881521
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63000
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAC1b, also named as TC25, belongs to the small GTPase superfamily and Rho family. RAC1 is a plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, it binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.

Publications

What published studies show

The RAC1 antibody (Cat# 66122-1-Ig) has 62 citations spanning high-impact journals including Nature Communications, Cancer Cell, Molecular Cell, Oncogene, Cell Reports, Circulation Research, and Journal of Biological Chemistry, among others. Research fields covered include oncology (lung, liver, bladder, thyroid cancers), immunology and inflammation, renal fibrosis, cardiovascular disease, neuroscience, metabolic regulation, and RAC1/Rho GTPase signaling pathways. Applications are predominantly Western blot, with IF, IHC, IP, and PLA also represented.

Automatically generated from the 62 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Human	WB	Cancer Cell; Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis; Authors - Wei Zhou
human,mouse	WB,IF	Cell Mol Immunol; Lipid droplets restrict phagosome formation in antifungal immunity; Authors - Wanwei Sun
human,mouse	WB	Cancer Res; Hypoxia Stimulates PYGB Enzymatic Activity to Promote Glycogen Metabolism and Cholangiocarcinoma Progression; Authors - Yani Pan
mouse	WB	Nat Commun; The gut microbe Bacteroides fragilis ameliorates renal fibrosis in mice; Authors - Wei Zhou
mouse	WB	Nat Commun; TLR4 signalling via Piezo1 engages and enhances the macrophage mediated host response during bacterial infection.; Authors - Jing Geng
human	PLA	Nat Commun; Regulation of local GTP availability controls RAC1 activity and cell invasion; Authors - Anna Bianchi-Smiraglia