PTGER4 Monoclonal antibody

PTGER4 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 66921-1-Ig
Clone No.4A2A12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, FC (Intra), ELISA

4A2A12, EP4, EP4R

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, rat brain tissue, mouse brain tissue, Jurkat cells, K-562 cells
Positive IHC detected inhuman prostate hyperplasia tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66921-1-Ig targets PTGER4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19262

Product name: Recombinant human PTGER4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 333-488 aa of BC101534

Sequence: RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI

Predict reactive species
Full Name prostaglandin E receptor 4 (subtype EP4)
Calculated Molecular Weight 488 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC101534
Gene Symbol PTGER4
Gene ID (NCBI) 5734
RRIDAB_2882248
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35408
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTGER4 (Prostaglandin E2 receptor EP4 subtype, also known as EP4R) is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.

Protocols

Product Specific Protocols
WB protocol for PTGER4 antibody 66921-1-IgDownload protocol
IHC protocol for PTGER4 antibody 66921-1-IgDownload protocol
IF protocol for PTGER4 antibody 66921-1-IgDownload protocol
FC protocol for PTGER4 antibody 66921-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Signal Transduct Target Ther

m6A demethylase ALKBH5 is required for antibacterial innate defense by intrinsic motivation of neutrophil migration.

Authors - Yang Liu
mouse,humanWB

J Mol Med (Berl)

Vav2 promotes ductus arteriosus anatomic closure via the remodeling of smooth muscle cells by Rac1 activation

Authors - Yinghui Chen
mouseIHC

Nat Commun

Post-resolution macrophages shape long-term tissue immunity and integrity in a mouse model of pneumococcal pneumonia

Authors - Karen T Feehan
mouse,humanWB

Cell Metab

m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1

Authors - Ling Xiao

Nat Neurosci

NG2 glia protect against prion neurotoxicity by inhibiting microglia-to-neuron prostaglandin E2 signaling

Authors - Yingjun Liu
mouseWB

Sci Rep

Prostaglandin E2 receptor EP4 activation induces tolerogenic dendritic cells to mitigate ischemic acute kidney injury

Authors - Chunyao Li
Loading...
||
New chat Able
正在加载,请稍候...