PSAP Polyclonal antibody

• 

  WB analysis of HeLa using 18398-1-AP

  WB result of PSAP antibody (18398-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HeLa cells.

• 

  WB analysis of HeLa using 18398-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18398-1-AP (PSAP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18398-1-AP

  WB result of PSAP antibody (18398-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAP transfected HepG2 cells.

• 

  IHC staining of human liver cancer using 18398-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18398-1-AP (PSAP antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver cancer using 18398-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18398-1-AP (PSAP antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of PC-3 using 18398-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 18398-1-AP (PSAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

PSAP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18398-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

Dispersin, CSAct, Component C, Co beta glucosidase, Cerebroside sulfate activator

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• CoIP: See 1 publications below

Product Information

18398-1-AP targets PSAP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13265

  Product name: Recombinant human PSAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-392 aa of BC001503

  Sequence: DVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR

• Full Name: prosaposin
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC001503
• Gene Symbol: PSAP
• Gene ID (NCBI): 5660
• RRID: AB_10598315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07602
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin C.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Hum Mol Genet; Lysosomal ceramides regulate Cathepsin B-mediated processing of saposin C and glucocerebrosidase activity.; Authors - Myung Jong Kim
human	WB	JCI Insight; Inhibition of cysteine protease cathepsin Lincreases the level and activity of lysosomal glucocerebrosidase; Authors - Myung Jong Kim