Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18398-1-AP targets PSAP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13265 Product name: Recombinant human PSAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 312-392 aa of BC001503 Sequence: DVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR Predict reactive species |
| Full Name | prosaposin |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC001503 |
| Gene Symbol | PSAP |
| Gene ID (NCBI) | 5660 |
| RRID | AB_10598315 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P07602 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin C.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSAP antibody 18398-1-AP | Download protocol |
| IHC protocol for PSAP antibody 18398-1-AP | Download protocol |
| WB protocol for PSAP antibody 18398-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Hum Mol Genet Lysosomal ceramides regulate Cathepsin B-mediated processing of saposin C and glucocerebrosidase activity. | ||
J Neurochem Prosaposin Is Cleaved Into Saposins by Multiple Cathepsins in a Progranulin-Regulated Fashion. | ||
JCI Insight Inhibition of cysteine protease cathepsin Lincreases the level and activity of lysosomal glucocerebrosidase |











