• Featured Product
  • KD/KO Validated

PSAP Polyclonal antibody

PSAP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 18398-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Dispersin, CSAct, Component C, Co beta glucosidase, Cerebroside sulfate activator

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18398-1-AP targets PSAP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13265

Product name: Recombinant human PSAP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 312-392 aa of BC001503

Sequence: DVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGTR

Predict reactive species
Full Name prosaposin
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC001503
Gene Symbol PSAP
Gene ID (NCBI) 5660
RRIDAB_10598315
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07602
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

proteins' (SAPs) that assist in the lysosomal hydrolysis of sphingolipids. After proteolytic processing of the presaposin protein, these 4 released polypeptides are functional activators. Saposin A was encoded by residues 60 to 143 of PSAP, saposin B by 195 to 275, saposin C by 311 to 390, and saposin D by 405 to 487. There are four 12-14 kDa heatstable glycoproteins. This antibody should recognize saposin C.

Protocols

Product Specific Protocols
IF protocol for PSAP antibody 18398-1-APDownload protocol
IHC protocol for PSAP antibody 18398-1-APDownload protocol
WB protocol for PSAP antibody 18398-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,CoIP

Hum Mol Genet

Lysosomal ceramides regulate Cathepsin B-mediated processing of saposin C and glucocerebrosidase activity.

Authors - Myung Jong Kim
humanWB

JCI Insight

Inhibition of cysteine protease cathepsin Lincreases the level and activity of lysosomal glucocerebrosidase

Authors - Myung Jong Kim
Loading...
||
New chat Able
正在加载,请稍候...