PROX1 Recombinant monoclonal antibody

• 

  WB analysis using 81778-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81778-1-RR (PROX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HuH-7 using 81778-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HuH-7 cells using PROX1 antibody (81778-1-RR, Clone: 2H12 ) at dilution of 1:1300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), PROX1 antibody (67438-1-Ig, Clone: 1D4B1, red).

PROX1 Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 81778-1-RR

Clone No.2H12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

PROX-1, Prospero homeobox protein 1, prospero homeobox 1, Homeobox prospero-like protein PROX1, 2H12

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells, SH-SY5Y cells
• Positive IF/ICC detected in: HuH-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:650-1:2600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81778-1-RR targets PROX1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1543

  Product name: Recombinant human PROX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 546-736 aa of BC024201

  Sequence: TAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLH

• Full Name: prospero homeobox 1
• Calculated Molecular Weight: 737 aa, 83 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC024201
• Gene Symbol: PROX1
• Gene ID (NCBI): 5629
• RRID: AB_2935579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92786
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PROX1, Prospero homeobox protein 1, belongs to the Prospero homeobox family and contain a Prospero-type homeobox DNA-binding domain. PROX1 plays a fundamental role in early development of CNS and regulates the expression of gene and development of postmitotic, undifferentiated neurons. Also, PROX1 is a required regulator of the development of the lymphatic system. This antibody is raised against part of C-terminal chain of human PROX1. The calculated molecular weight of PROX1 is 83 kDa, but with post-translational modifications, PROX1 is about 90 kDa.