Tested Applications
| Positive WB detected in | mouse brain tissue, human brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human brain tissue, human cerebellum tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, SH-SY5Y cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14364-1-AP targets PKC Gamma in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5681 Product name: Recombinant human PRKCG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 351-697 aa of BC047876 Sequence: FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM Predict reactive species |
| Full Name | protein kinase C, gamma |
| Calculated Molecular Weight | 78 kDa |
| Observed Molecular Weight | 76-80 kDa |
| GenBank Accession Number | BC047876 |
| Gene Symbol | PKC Gamma |
| Gene ID (NCBI) | 5582 |
| RRID | AB_2300044 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05129 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC gamma is a neuron-specific member of the classical PKCs and is activated and translocated to subcellular regions as a result of various stimuli, including diacylglycerol synthesis, increased intracellular Ca(2+) and phorbol esters. Defects in this protein have been associated with spinocerebellar ataxia type 14 (SCA14), an autosomal dominant neurodegenerative disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IF protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IHC protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| IP protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| WB protocol for PKC Gamma antibody 14364-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PKC Gamma Polyclonal antibody (Cat# 14364-1-AP) has 19 citations spanning journals including Sci Adv, J Clin Invest, Acta Pharm Sin B, Cancer Lett, J Neuroinflammation, J Neurosci, Inflamm Bowel Dis, Toxicology, Neuropharmacology, Breast Cancer Res, Cell Oncol, Hear Res, Chemosphere, J Ethnopharmacol, Eur J Pharmacol, Toxics, Cell Transplant, J Neurosci Methods, and Heliyon. Research fields cover oncology, neuroscience, toxicology, immunology, pharmacology, and metabolic regulation.
| Species | Application | Title |
|---|---|---|
Acta Pharm Sin B PKCα inhibitors promote breast cancer immune evasion by maintaining PD-L1 stability | ||
J Clin Invest Mutant THAP11 causes cerebellar neurodegeneration and triggers TREM2-mediated microglial activation in mice | ||
Sci Adv Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1. | ||
Cancer Lett Integrative analysis of lactylation patterns reveals prognostic biomarkers and therapeutic targets in pancreatic cancer. | ||
J Neuroinflammation Dynamic phosphorylation of Fascin-1 orchestrates microglial phagocytosis and neurological recovery after spinal cord injury | ||
Chemosphere Perinatal exposure to nonylphenol impairs dendritic outgrowth of cerebellar Purkinje cells in progeny. |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. One user tested it by immunohistochemistry at a 1:100 dilution and reported excellent resolution and staining. Another user validated it by Western Blot at a 1:1000 dilution on mesenchymal stem cells, noting a clear single band. Overall, customers find the antibody reliable across applications, delivering sharp, specific results with minimal background.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Asan (Verified Customer) (10-31-2025) | Works well, nice resolution and staining
|
Chiara (Verified Customer) (10-04-2021) | Clear single band
|
