PKC Gamma Polyclonal antibody

• 

  WB analysis of mouse brain using 14364-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14364-1-AP (PKC gamma antibody at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14364-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14364-1-AP (PKC gamma antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14364-1-AP

  IP result of anti-PKC Gamma (IP:14364-1-AP, 4ug; Detection:14364-1-AP 1:500) with mouse brain tissue lysate 2640ug.

• 

  IHC staining of human brain using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14364-1-AP (PKC gamma antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14364-1-AP (PKC gamma antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain using 14364-1-AP (PKC gamma antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of rat brain using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain using 14364-1-AP (PKC gamma antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cerebellum using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14364-1-AP (PKC gamma antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human cerebellum using 14364-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 14364-1-AP (PKC gamma antibody at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 14364-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 14364-1-AP (PKC gamma antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of SH-SY5Y using 14364-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed SH-SY5Y cells using 14364-1-AP (PKC gamma antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HeLa using 14364-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human PKC Gamma (14364-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

PKC Gamma Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14364-1-AP

Publications(15)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

PRKCG, Protein kinase C gamma type, PKC-gamma, PKCG, PKCC

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue, human cerebellum tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, SH-SY5Y cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 13 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

14364-1-AP targets PKC Gamma in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5681

  Product name: Recombinant human PRKCG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-697 aa of BC047876

  Sequence: FSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

• Full Name: protein kinase C, gamma
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 76-80 kDa
• GenBank Accession Number: BC047876
• Gene Symbol: PKC Gamma
• Gene ID (NCBI): 5582
• RRID: AB_2300044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05129
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC gamma is a neuron-specific member of the classical PKCs and is activated and translocated to subcellular regions as a result of various stimuli, including diacylglycerol synthesis, increased intracellular Ca(2+) and phorbol esters. Defects in this protein have been associated with spinocerebellar ataxia type 14 (SCA14), an autosomal dominant neurodegenerative disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Sci Adv; Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1.; Authors - Odetta Antico
rat	WB	Chemosphere; Perinatal exposure to nonylphenol impairs dendritic outgrowth of cerebellar Purkinje cells in progeny.; Authors - Mingdan You
human	WB	Cell Oncol (Dordr); The SLITRK4-CNPY3 axis promotes liver metastasis of gastric cancer by enhancing the endocytosis and recycling of TrkB in tumour cells; Authors - Yao-Qi Zhou
mouse	IHC	J Neurosci; Dendritic Spine Dynamics after Peripheral Nerve Injury: An Intravital Structural Study.; Authors - Curtis A Benson
rat	WB	J Ethnopharmacol; Analgesic effects and possible mechanisms of iridoid glycosides from Lamiophlomis rotata (Benth.) Kudo in rats with spared nerve injury.; Authors - Yanan Zheng
mouse	WB,IF	Inflamm Bowel Dis; LRRC19 Promotes Permeability of the Gut Epithelial Barrier Through Degrading PKC-ζ and PKCι/λ to Reduce Expression of ZO1, ZO3, and Occludin.; Authors - Xiaomin Su

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Chiara (Verified Customer) (10-04-2021)

Clear single band

• Applications: Western Blot
• Primary Antibody Dilution: 1000
• Cell Tissue Type: mesenchymal Stem cell