Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, A431 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10308-1-AP targets AMPK Beta 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0301 Product name: Recombinant human PRKAB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 62-269 aa of BC001007 Sequence: AWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKP Predict reactive species |
| Full Name | protein kinase, AMP-activated, beta 1 non-catalytic subunit |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001007 |
| Gene Symbol | PRKAB1 |
| Gene ID (NCBI) | 5564 |
| RRID | AB_513239 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y478 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| IHC protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| IP protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| WB protocol for AMPK Beta 1 antibody 10308-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AMPK Beta 1 Polyclonal antibody (Cat# 10308-1-AP) has 31 citations published in journals including Cell Metabolism, Autophagy, Theranostics, Acta Pharmaceutica Sinica B, EMBO Journal, Cell Reports, Cell Death & Disease, Food Chemistry, and Journal of Ethnopharmacology. Research fields encompass metabolic stress, nonalcoholic steatohepatitis, obesity, lipid metabolism, autophagy, ferroptosis, multiple cancers (breast, colorectal, cervical, lung, thyroid, esophageal, hepatocellular), aging, neurodegeneration, liver disease, diabetes, gut microbiota, and inflammation. Primary applications are WB, IP, IF, and IHC across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway | ||
Theranostics Injectable SF-platform orchestrates GPX4-targeted ferroptosis-autophagy-immunogenic circuit for overcoming oxidative resistance in triple-negative breast cancer | ||
Theranostics Therapeutic inhibition of miR-802 protects against obesity through AMPK-mediated regulation of hepatic lipid metabolism. | ||
Acta Pharm Sin B Engineering cannabidiol synergistic carbon monoxide nanocomplexes to enhance cancer therapy via excessive autophagy | ||
Acta Pharm Sin B IMM-H007 promotes hepatic cholesterol and triglyceride metabolism by activating AMPKα to attenuate hypercholesterolemia. |
