AMPK Alpha 2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 18167-1-AP

  WB result of AMPK alpha 2 antibody (18167-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-AMPK alpha 2 transfected HEK-293 cells.

• 

  WB analysis using 18167-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 18167-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 18167-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 18167-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat ovary using 18167-1-AP

  rat ovary tissue were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18167-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 18167-1-AP

  IP result of anti-AMPK Alpha 2 (IP:18167-1-AP, 4ug; Detection:18167-1-AP 1:1000) with mouse skeletal muscle tissue lysate 3600ug.

• 

  IHC staining of human breast cancer using 18167-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 18167-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18167-1-AP (AMPK alpha 2 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 18167-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 18167-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 18167-1-AP (AMPK alpha 2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 18167-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using AMPK Alpha 2 antibody (18167-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

AMPK Alpha 2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18167-1-AP

Publications(62)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

AMPK, AMPK alpha 2, AMPK subunit alpha 2, AMPK2, AMPKA2, AMPKα2, PRKAA, PRKAA2

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, human skeletal muscle tissue, rat ovary tissue, SKOV-3 cells, MCF-7 cells
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 11 publications below
• WB: See 55 publications below
• IHC: See 4 publications below
• IF: See 4 publications below
• IP: See 3 publications below

Product Information

18167-1-AP targets AMPK Alpha 2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12796

  Product name: Recombinant human PRKAA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 215-552 aa of BC069680

  Sequence: DDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR

• Full Name: protein kinase, AMP-activated, alpha 2 catalytic subunit
• Calculated Molecular Weight: 552 aa, 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC069680
• Gene Symbol: AMPK Alpha 2
• Gene ID (NCBI): 5563
• RRID: AB_10695046
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54646
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKAA2(protein kinase, AMP-activated, alpha 2 catalytic subunit), also named as AMPKA2, AMPK, PRKAA, AMPK2, belongs to the CAMK Ser/Thr protein kinase family and SNF1 subfamily. PRKAA2 is an αβγ heterotrimer that is activated by low cellular energy status, such as decreases in both the ATP/AMP ratio and the phosphocreatine content and it is a glycogen synthase kinase, phosphorylating Ser7 at the NH2 terminus, which decreases glycogen synthase activity (PMID:14532170). The protein can be ubiquitinated (PMID:21224036).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; Dietary timing enhances exercise by modulating fat-muscle crosstalk via adipocyte AMPKα2 signaling; Authors - Jianghui Chen
mouse	WB	Cell Metab; Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism.; Authors - Yi Fu
mouse	WB	Autophagy; Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway; Authors - Meng Chen
human	WB	Dev Cell; Endothelial progenitor cells control remodeling of uterine spiral arteries for the establishment of utero-placental circulation; Authors - Bin Tan
rat	WB	ACS Appl Mater Interfaces; Biocompatible Chitin Hydrogel Incorporated with PEDOT Nanoparticles for Peripheral Nerve Repair.; Authors - Lin Huang
human	WB	Autophagy; TSPAN1 promotes autophagy flux and mediates cooperation between WNT-CTNNB1 signaling and autophagy via the MIR454-FAM83A-TSPAN1 axis in pancreatic cancer.; Authors - Cefan Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

YINGJIAN (Verified Customer) (08-15-2025)

high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: heart

AMPK Alpha 2 Antibody Western Blot validation (1:5000 dilution) in heart (Cat no:18167-1-AP)