Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PPARGC1B Polyclonal antibody

PPARGC1B Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IP, CoIP, ELISA

ERRL1, PERC, Peroxisome proliferator activated receptor gamma coactivator 1 beta, Peroxisome proliferator-activated receptor gamma coactivator 1-beta, PGC1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PPARGC1B in ?

Tested Applications

Positive WB detected inHEK-293 cells, SH-SY5Y cells, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22378-1-AP targets PPARGC1B in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig, zebrafish, goat, fish, megalobrama amblycephala
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17566

Product name: Recombinant human PPARGC1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC132971

Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

Predict reactive species
Full Name peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Calculated Molecular Weight 1023 aa, 113 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC132971
Gene Symbol PPARGC1B
Gene ID (NCBI) 133522
RRIDAB_2879093
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86YN6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPARGC1B (Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta) is a transcriptional coactivator that plays a key role in the regulation of cellular energy metabolism, particularly in tissues with high metabolic demands such as the heart, skeletal muscle, liver, and brain. Encoded by the PPARGC1B gene in humans, it interacts with a variety of nuclear receptors and transcription factors, including PPARs, ERRs, and NRF1, to promote the expression of genes involved in mitochondrial biogenesis, oxidative phosphorylation, fatty acid oxidation, and glucose homeostasis. Unlike its close paralog PGC-1α, PGC-1β is less responsive to physiological stimuli like cold exposure or exercise but is more constitutively expressed and tightly linked to lipid metabolism and reactive oxygen species (ROS) detoxification.

Protocols

Product Specific Protocols
IP protocol for PPARGC1B antibody 22378-1-APDownload protocol
WB protocol for PPARGC1B antibody 22378-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PGC-1β (Cat# 22378-1-AP) has 22 citations across journals including Cancer Research, Cell Reports, Redox Biology, Advanced Science, EMBO Reports, FASEB Journal, Molecular Metabolism, FEBS Journal, Nutrients, Frontiers in Nutrition, Scientific Reports, and Science Advances. Research fields span cancer (glioma, colon, thyroid, melanoma), metabolism (mitochondrial biogenesis, lipid metabolism, oxidative phosphorylation), diabetes, bone disease, cardiology, reproductive biology, and animal nutrition. Applications are predominantly WB and CoIP across human, mouse, zebrafish, pig, goat, and fish species.

SpeciesApplicationTitle
humanWB

Cancer Res

PGC-1α degradation suppresses mitochondrial biogenesis to confer radiation resistance in glioma

Authors - Mengjie Zhao
mouseWB

Redox Biol

miR-484 mediates oxidative stress-induced ovarian dysfunction and promotes granulosa cell apoptosis via SESN2 downregulation

Authors - Xiaofei Wang
humanWB

Adv Sci (Weinh)

Metabolism-Based Molecular Subtyping Endows Effective Ketogenic Therapy in p53-Mutant Colon Cancer

Authors - Meng Tang
mouseWB

BMC Med

MTHFD2 promotes osteoclastogenesis and bone loss in rheumatoid arthritis by enhancing CKMT1-mediated oxidative phosphorylation

Authors - Yujing Li
GoatWB

J Anim Sci Biotechnol

miR-25 modulates triacylglycerol and lipid accumulation in goat mammary epithelial cells by repressing PGC-1beta.

Authors - Liuan Ma
humanWB

Cell Rep

Muscle satellite cells are impaired in type 2 diabetic mice by elevated extracellular adenosine.

Authors - Lifang Han

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One user (Mounika V.) rated this antibody 5/5 stars in December 2025. Using lot 00019489 at a 1:400 dilution for Western Blot and Immunoprecipitation, they reported that the antibody works well with good visibility. Overall, the feedback is positive, confirming reliable performance and clear signal in both WB and IP applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (12-25-2025)

Antibodies are working good, visibility is good!

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:400
Loading...
||
New chat

Able™

正在加载,请稍候...