POLR2F Polyclonal antibody

• 

  WB analysis using 15334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15334-1-AP (POLR2F antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15334-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15334-1-AP (POLR2F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15334-1-AP (POLR2F Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human placenta using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15334-1-AP (POLR2F Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human placenta using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15334-1-AP (POLR2F Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human cervical cancer using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 15334-1-AP (POLR2F antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 15334-1-AP (POLR2F antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human cervical cancer using 15334-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 15334-1-AP (POLR2F Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of A431 using 15334-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using POLR2F antibody (15334-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

POLR2F Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15334-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RPABC14.4, POLRF, HRBP14.4, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: human cervical cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

15334-1-AP targets POLR2F in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7449

  Product name: Recombinant human POLR2F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-127 aa of BC003582

  Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

• Full Name: polymerase (RNA) II (DNA directed) polypeptide F
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC003582
• Gene Symbol: POLR2F
• Gene ID (NCBI): 5435
• RRID: AB_10858229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61218
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; Targeted protein degradation reveals RNA Pol II heterogeneity and functional diversity; Authors - Yuanjun Li
mouse	WB	Cell Biosci; Replication and transcription machinery for ranaviruses: components, correlation, and functional architecture.; Authors - Fei Ke ; KD Validated
mouse	WB	Nat Commun; The transcriptional coactivator RUVBL2 regulates Pol II clustering with diverse transcription factors; Authors - Hui Wang
mouse		Genome Biol; Cross-regulome profiling of RNA polymerases highlights the regulatory role of polymerase III on mRNA transcription by maintaining local chromatin architecture; Authors - Yongpeng Jiang