POLR2D Polyclonal antibody

• 

  WB analysis using 16093-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16093-1-AP (POLR2D antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16093-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16093-1-AP (POLR2D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16093-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16093-1-AP (POLR2D antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 16093-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16093-1-AP (POLR2D antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 16093-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16093-1-AP (POLR2D antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 16093-1-AP

  IP result of anti-POLR2D (IP:16093-1-AP, 4ug; Detection:16093-1-AP 1:800) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of mouse testis using 16093-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 16093-1-AP (POLR2D antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 16093-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 16093-1-AP (POLR2D antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

POLR2D Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16093-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

DNA-directed RNA polymerase II subunit D, DNA-directed RNA polymerase II subunit RPB4, HSRBP4, HSRPB4, RNA polymerase II RPB4

---

Tested Applications

• Positive WB detected in: HeLa cells, rat liver tissue, rat skeletal muscle tissue, HepG2 cells, MCF-7 cells
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

16093-1-AP targets POLR2D in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8701

  Product name: Recombinant human POLR2D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC017205

  Sequence: MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

• Full Name: polymerase (RNA) II (DNA directed) polypeptide D
• Calculated Molecular Weight: 142 aa, 16 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC017205
• Gene Symbol: POLR2D
• Gene ID (NCBI): 5433
• RRID: AB_2284144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15514
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Cell; RNA Pol II preferentially regulates ribosomal protein expression by trapping disassociated subunits; Authors - Yuanjun Li
mouse	WB	Mol Cell; Targeted protein degradation reveals RNA Pol II heterogeneity and functional diversity; Authors - Yuanjun Li
human	WB	Elife; A cryptic K48 ubiquitin chain binding site on UCH37 is required for its role in proteasomal degradation.; Authors - Jiale Du

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

chang wei (Verified Customer) (02-18-2020)

It works well for western blot of Hela S3 whole cell lysates at 1:1000 dilution with incubation at 4 degree overnight.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HeLa S3