Tested Applications
| Positive WB detected in | HUVEC cells, human peripheral blood platelets, Jurkat cells, THP-1 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human tonsillitis tissue, human placenta tissue, human renal cell carcinoma tissue, human hepatocirrhosis tissue, human kidney tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human endometrial cancer tissue, human tonsillitis tissue |
| Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:10000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11265-1-AP targets CD31 in WB, IHC, IF/ICC, IF-P, IP, ELISA, VM staining applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, canine, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1787 Product name: Recombinant human CD31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species |
| Full Name | platelet/endothelial cell adhesion molecule |
| Calculated Molecular Weight | 83 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | BC022512 |
| Gene Symbol | CD31 |
| Gene ID (NCBI) | 5175 |
| ENSEMBL Gene ID | ENSG00000261371 |
| RRID | AB_2299349 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16284 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD31 antibody 11265-1-AP | Download protocol |
| IHC protocol for CD31 antibody 11265-1-AP | Download protocol |
| IP protocol for CD31 antibody 11265-1-AP | Download protocol |
| WB protocol for CD31 antibody 11265-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CD31 (PECAM-1) polyclonal antibody (Cat# 11265-1-AP) has 685 citations across journals including Nature Communications, Advanced Materials, Biomaterials, Cancer Research, Theranostics, Journal of Nanobiotechnology, Science Advances, and Signal Transduction and Targeted Therapy. Associated research fields include angiogenesis, tumor biology, wound healing, tissue engineering, diabetic complications, bone regeneration, nerve repair, cardiovascular disease, fibrosis, ferroptosis, and immunology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Signal Transduct Target Ther Suppression of PFKFB3-driven glycolysis restrains endothelial-to-mesenchymal transition and fibrotic response | ||
Signal Transduct Target Ther Aberrant Notch-signaling promotes tumor angiogenesis in esophageal squamous-cell carcinoma | ||
Imeta Single-cell sequencing reveals the role of IL-33 + endothelial subsets in promoting early gastric cancer progression | ||
Mol Cancer Exosomal circSHKBP1 promotes gastric cancer progression via regulating the miR-582-3p/HUR/VEGF axis and suppressing HSP90 degradation. | ||
Mol Cancer CircPTPRA blocks the recognition of RNA N6-methyladenosine through interacting with IGF2BP1 to suppress bladder cancer progression. |
Reviews
What customers say
Users report positive experiences with this antibody. One reviewer (5/5) used it for Western Blot at 1:1000 dilution and described it as a "very good antibody." Another reviewer (4/5) applied it for immunohistochemistry on human FFPE breast cancer tissue at pH 9. Overall, the antibody performs well across applications including WB and IHC, with users finding it reliable for both protein detection and tissue-based studies.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (01-08-2026) | VERY GOOD ANTIBODY
|
Maelle (Verified Customer) (11-29-2024) | ph9 Human FFPE
|
