PDK1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDK1 Polyclonal antibody (18262-1-AP)

• Featured Product
• KD/KO Validated

PDK1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 18262-1-AP

Publications(83)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial, EC:2.7.11.2, PDH kinase 1, PDHK1

• 

  WB analysis using 18262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18262-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18262-1-AP (PDK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SiHa using 18262-1-AP

  IP result of anti-PDK1 (IP:18262-1-AP, 4ug; Detection:18262-1-AP 1:3000) with SiHa cells lysate 1520 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18262-1-AP (PDK1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 18262-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 18262-1-AP (PDK1 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HEK-293 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: SiHa cells
• Positive IHC detected in: human liver cancer tissue, human heart tissue, human kidney tissue, human breast cancer tissue, mouse kidney tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18262-1-AP targets PDK1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13121

  Product name: Recombinant human PDK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-436 aa of BC039158

  Sequence: MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

• Full Name: pyruvate dehydrogenase kinase, isozyme 1
• Calculated Molecular Weight: 436 aa, 49 kDa
• Observed Molecular Weight: 46-55 kDa
• GenBank Accession Number: BC039158
• Gene Symbol: PDK1
• Gene ID (NCBI): 5163
• RRID: AB_10598310
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15118
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDK1(pyruvate dehydrogenase kinase isoform 1) is also named as PDHK1 and belongs to the PDK/BCKDK protein kinase family. It inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism (PMID:17683942). Starvation increases islet PDK activity (PMID:11723055). PDK1 has 2 isoforms with the MW of 49 and 52 kD, and a 28aa-transit-peptide in the N-terminal can be removed in the mature form. This antibody is specific to PDK1.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; A novel polypeptide encoded by the circular RNA ZKSCAN1 suppresses HCC via degradation of mTOR; Authors - Runjie Song
human	IF	Cell Metab; Derepressing nuclear pyruvate dehydrogenase induces therapeutic cancer cell reprogramming; Authors - Ting Zhao
mouse	WB	Bioact Mater; Polydopamine-mediated graphene oxide and nanohydroxyapatite-incorporated conductive scaffold with an immunomodulatory ability accelerates periodontal bone regeneration in diabetes.; Authors - Yazhen Li
mouse	WB	Nat Commun; PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis.; Authors - Li Zhao
human	WB	Nat Commun; The SIAH2-NRF1 axis spatially regulates tumor microenvironment remodeling for tumor progression.; Authors - Biao Ma
human	WB	Nat Commun; Hypoxia-induced downregulation of PGK1 crotonylation promotes tumorigenesis by coordinating glycolysis and the TCA cycle; Authors - Zihao Guo