PCP2 Polyclonal antibody

• 

  IHC staining of mouse cerebellum using 13774-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13774-1-AP (PCP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 13774-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 13774-1-AP (PCP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 13774-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 13774-1-AP (PCP2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 13774-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 13774-1-AP (PCP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse cerebellum using 13774-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using PCP2 antibody (13774-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse cerebellum using 13774-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using PCP2 antibody (13774-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PCP2 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 13774-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

Purkinje cell protein 2, L7, GPSM4

---

Tested Applications

• Positive IHC detected in: mouse cerebellum tissue, mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse cerebellum tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13774-1-AP targets PCP2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4759

  Product name: Recombinant human PCP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC038715

  Sequence: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP

• Full Name: Purkinje cell protein 2
• Calculated Molecular Weight: 136 aa, 15 kDa
• GenBank Accession Number: BC038715
• Gene Symbol: PCP2
• Gene ID (NCBI): 126006
• RRID: AB_2935435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVA1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pcp2 is uniquely expressed in cerebellar Purkinje cells and in retinal bipolar neurons, and it may function as a cell-type specific modulator for G protein-mediated cell signaling.