P2RY12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P2RY12 Polyclonal antibody (11976-1-AP)

P2RY12 Polyclonal Antibody for WB, ELISA

Cat No. 11976-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

ADP glucose receptor, ADPG R, HORK3, P2RY12, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12, P2Y12 platelet ADP receptor, SP1999

• 

  WB analysis of mouse spinal cord using 11976-1-AP

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human adrenal gland using 11976-1-AP

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for P2RY12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse spinal cord tissue, human adrenal gland tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11976-1-AP targets P2RY12 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2601

  Product name: Recombinant human P2RY12 protein

  Source: e coli.-derived, T-GST

  Tag: GST

  Domain: 1-342 aa of BC017898

  Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

• Full Name: purinergic receptor P2Y, G-protein coupled, 12
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC017898
• Gene Symbol: P2RY12
• Gene ID (NCBI): 64805
• RRID: AB_11182489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

11976-1-AP is a P2RY12 polyclonal antibody with 13 total citations. Citations appear in Phytomedicine, Cell Reports, Cell Mol Life Sci, J Am Heart Assoc, Neurobiology of Disease, Inflammation, Frontiers in Pharmacology, Cell Signaling, iScience, Neuroscience, Mol Biol Rep, Purinergic Signal, and Nature Communications. Research fields span neuroinflammation, neuropathic pain, stroke, cardiovascular disease, epilepsy, retinal degeneration, obesity, diabetic cardiomyopathy, osteoarthritis, pyroptosis, and tumor progression.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Phytomedicine; Xuefu Zhuyu Decoction Ameliorates Neuroinflammation after Traumatic Brain Injury via tRF-3-Leu-AAG/Gpr17 axis.; Authors - Zhaoyu Yang
		Cell Rep; Microglial macrophage-derived ds-HMGB1 in DRG orchestrates neuropathic pain through immune-neural signaling.; Authors - Yang Yang
mouse	WB	Cell Mol Life Sci; Multiplexed mRNA analysis of brain-derived extracellular vesicles upon experimental stroke in mice reveals increased mRNA content with potential relevance to inflammation and recovery processes.; Authors - Annika Bub
human	WB	J Am Heart Assoc; Influence of GAS5/MicroRNA-223-3p/P2Y12 Axis on Clopidogrel Response in Coronary Artery Disease; Authors - Yan-Ling Liu
mouse	WB	Neurobiol Dis; A recessive Trim2 mutation causes an axonal neuropathy in mice.; Authors - Jian J Li
rat	WB	Front Pharmacol; Transdermal administration of herbal essential oil alleviates high-fat diet-induced obesity by regulating metabolism and gut microbiota; Authors - Zu-Wen Ye