P2RY12 Polyclonal antibody

• 

  WB analysis of mouse spinal cord using 11976-1-AP

  mouse spinal cord tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human adrenal gland using 11976-1-AP

  human adrenal gland tissue were subjected to SDS PAGE followed by western blot with 11976-1-AP (P2RY12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

P2RY12 Polyclonal Antibody for WB, ELISA

Cat No. 11976-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

ADP glucose receptor, ADPG R, HORK3, P2RY12, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12, P2Y12 platelet ADP receptor, SP1999

---

Tested Applications

• Positive WB detected in: mouse spinal cord tissue, human adrenal gland tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IF: See 1 publications below

Product Information

11976-1-AP targets P2RY12 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2601

  Product name: Recombinant human P2RY12 protein

  Source: e coli.-derived, T-GST

  Tag: GST

  Domain: 1-342 aa of BC017898

  Sequence: MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM

• Full Name: purinergic receptor P2Y, G-protein coupled, 12
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC017898
• Gene Symbol: P2RY12
• Gene ID (NCBI): 64805
• RRID: AB_11182489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Mol Life Sci; Multiplexed mRNA analysis of brain-derived extracellular vesicles upon experimental stroke in mice reveals increased mRNA content with potential relevance to inflammation and recovery processes.; Authors - Annika Bub
mouse	WB	Neurobiol Dis; A recessive Trim2 mutation causes an axonal neuropathy in mice.; Authors - Jian J Li
mouse	WB	Neuroscience; HC067047 Ameliorates SAE by Suppressing Endoplasmic Reticulum Stress and Oxidative Stress-Induced Pyroptosis in the Hippocampi of Mice; Authors - Xiaolin Zhong
human	WB	Mol Biol Rep; Upregulation of P2Y12 inhibits chondrocyte apoptosis in lumbar osteoarthritis through the PI3K/AKT signaling pathway; Authors - Guanyin Wu
mouse	WB	iScience; The mechanisms and therapeutic potential of clopidogrel in mitigating diabetic cardiomyopathy in db/db mice; Authors - Bing Li
human	WB	J Am Heart Assoc; Influence of GAS5/MicroRNA-223-3p/P2Y12 Axis on Clopidogrel Response in Coronary Artery Disease; Authors - Yan-Ling Liu