NPHP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NPHP3 Polyclonal antibody (22026-1-AP)

NPHP3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 22026-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KIAA2000, MKS7, Nephrocystin 3, Nephrocystin-3

• 

  WB analysis using 22026-1-AP

  mouse testis lysates were subjected to SDS PAGE followed by western blot with 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 22026-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 22026-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 22026-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 22026-1-AP (NPHP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 22026-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 22026-1-AP (NPHP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 22026-1-AP

  IP result of anti-NPHP3 (IP:22026-1-AP, 4ug; Detection:22026-1-AP 1:1000) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 22026-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 22026-1-AP (NPHP3 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 22026-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 22026-1-AP (NPHP3 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 22026-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse ovary using 22026-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat ovary using 22026-1-AP

  Immunohistochemical analysis of paraffin-embedded rat ovary tissue slide using 22026-1-AP (NPHP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of hTERT-RPE1 cells using 22026-1-AP

  IF result (the base and the lower half of cilia stain) of anti-NPHP3 (22026-1-AP, 1:50) with serum-starved hTERT-RPE1 (MeOH fixed) by Dr. Moshe Kim.

• 

  IF Staining of MDCK using 22026-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MDCK cells using 22026-1-AP (NPHP3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HepG2 cells, HEK-293 cells, mouse liver tissue, human testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells, MDCK cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22026-1-AP targets NPHP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

• Tested Reactivity: human, mouse, rat, canine
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16888

  Product name: Recombinant human NPHP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC068082

  Sequence: MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRRGAGAAAGAGPGSLPRGVGAGGLLGASFKSTGSSVPELEYAAAEYERLRKEYEIFRVSKNQELLSMGRREAKLDTENKRLRAELQ

• Full Name: nephronophthisis 3 (adolescent)
• Calculated Molecular Weight: 1330 aa, 151 kDa
• Observed Molecular Weight: 145-151 kDa
• GenBank Accession Number: BC068082
• Gene Symbol: NPHP3
• Gene ID (NCBI): 27031
• RRID: AB_2878975
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z494
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Methods; Genetically encoded calcium indicator illuminates calcium dynamics in primary cilia.; Authors - Su Steven S
human	IF	Am J Hum Genet; ARL3 Mutations Cause Joubert Syndrome by Disrupting Ciliary Protein Composition.; Authors - Sumaya Alkanderi
human	IF	Hum Mol Genet; Translational read-through of the RP2 Arg120stop mutation in patient iPSC-derived retinal pigment epithelial cells.; Authors - Nele Schwarz
mouse	IF	Int J Mol Sci; Ciliary Proteins Repurposed by the Synaptic Ribbon: Trafficking Myristoylated Proteins at Rod Photoreceptor Synapses.; Authors - Shweta Suiwal
mouse	WB	J Am Soc Nephrol; DNAJB11 -Kidney Disease Develops from Reduced Polycystin-1 Dosage but not Unfolded Protein Response in Mice; Authors - Sounak Ghosh Roy
		Methods Cell Biol; Single-molecule imaging in the primary cilium; Authors - Lucien E Weiss

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lelongt (Verified Customer) (12-10-2021)

Immunofluorescence is observed in mice cilia but is not restricted to the inversin compartment. Dilution has to be adjusted for WB since there are few bands.

• Applications: Western Blot, Immunohistochemistry
• Primary Antibody Dilution: 1/100 immunofluoresecence mice. 1/1000 WB dog
• Cell Tissue Type: mouce parrafin sections (immunoflorescence). MDCK cells (Western blot)