• Featured Product
  • KD/KO Validated

NEDD4 Polyclonal antibody

NEDD4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21698-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Cell proliferation-inducing gene 53 protein, E3 ubiquitin-protein ligase NEDD4, EC:2.3.2.26, HECT-type E3 ubiquitin transferase NEDD4, KIAA0093

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, C6 cells, HeLa cells, HT-1080 cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, COS-7 cells
Positive IP detected inC6 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21698-1-AP targets NEDD4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16291

Product name: Recombinant human NEDD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 970-1319 aa of BC152452

Sequence: TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 4
Calculated Molecular Weight 1319 aa, 149 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC152452
Gene Symbol NEDD4
Gene ID (NCBI) 4734
RRIDAB_10858626
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46934
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD4 and similar proteins discovered subsequently became a family of HECT ligases, comprising 9 human proteins including NEDD4, NEDD4-2 (NEDD4L), ITCH, SMURF1, SMURF2, WWP1, WWP2, NEDL1 and NEDL2 (PMID: 23545411). NEDD4 is a highly evolutionarily conserved protein from yeast to man, and was initially cloned as a highly expressed gene in the early embryonic brain (PMID: 35328067). NEDD4 is frequently overexpressed in many different types of cancer, and decreased levels of NEDD4 can also be associated with cancer. It can be a potential therapeutic target for the treatment of human cancer.(PMID: 25527121). The human NEDD4 gene is located on chromosome 15q21.3 and comprises 30 exons (HGNC:7727) shown to encode a ~120 KDa protein. Otherwise there is a 75 kDa isoform in addition to full length NEDD4 (PMID: 24907641).

Protocols

Product Specific Protocols
WB protocol for NEDD4 antibody 21698-1-APDownload protocol
IHC protocol for NEDD4 antibody 21698-1-APDownload protocol
IF protocol for NEDD4 antibody 21698-1-APDownload protocol
IP protocol for NEDD4 antibody 21698-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Adv Sci (Weinh)

OTUD5 Protects Dopaminergic Neurons by Promoting the Degradation of α-Synuclein in Parkinson's Disease Model

Authors - Xiaomeng Song
mouseWB

Dev Cell

DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice

Authors - Dingfeng Zou
humanWB

J Exp Clin Cancer Res

PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer

Authors - Liang Xu
mouseWB

J Biomed Sci

Tudor-SN exacerbates pathological vascular remodeling by promoting the polyubiquitination of PTEN via NEDD4-1

Authors - Yichen Wu
mouseWB

Proc Natl Acad Sci U S A

Zbtb7b engages the long noncoding RNA Blnc1 to drive brown and beige fat development and thermogenesis.

Authors - Siming Li
humanWB

Theranostics

PINCH-1 promotes IGF-1 receptor expression and skin cancer progression through inhibition of the GRB10-NEDD4 complex.

Authors - Xiaoxiao Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tongbin (Verified Customer) (08-25-2020)

This NEDD4 antibody works very well in western blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Heart
Loading...