NDRG2 Monoclonal antibody

• 

  WB analysis using 67191-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67191-1-Ig (NDRG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67191-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67191-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67191-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67191-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67191-1-Ig (NDRG2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NDRG2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67191-1-Ig

Clone No.3E3F4

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Rat, Mouse, Pig and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

DKFZp781G1938, FLJ25522, KIAA1248, NDRG family member 2, NDRG2, Protein NDRG2, Protein Syld709613, SYLD

---

Tested Applications

• Positive WB detected in: human heart tissue, pig brain tissue, rat brain tissue, mouse brain tissue, pig heart tissue, rat heart tissue
• Positive IHC detected in: mouse brain tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

67191-1-Ig targets NDRG2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Rat, Mouse, Pig samples.

• Tested Reactivity: Human, Rat, Mouse, Pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28612

  Product name: Recombinant human NDRG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-357 aa of BC010458

  Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

• Full Name: NDRG family member 2
• Calculated Molecular Weight: 371 aa, 39 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC010458
• Gene Symbol: NDRG2
• Gene ID (NCBI): 57447
• RRID: AB_2882486
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UN36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Sci Adv; Astrocytic NDRG2-PPM1A interaction exacerbates blood-brain barrier disruption after subarachnoid hemorrhage; Authors - Dayun Feng