Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MMP3 Polyclonal antibody

The MMP3 polyclonal antibody (17873-1-AP) is one of the most highly cited MMP3 antibodies in the market. It is suitable for WB, IF/ICC, ELISA and has been referenced in over 348 publications.

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (4)

Applications

WB, IHC, IF/ICC, ELISA

EC:3.4.24.17, Matrix metalloproteinase-3, MMP 3, MMP-3, SL-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MMP3 in ?

Tested Applications

Positive WB detected inA2780 cells, A549 cells, HeLa cells, human skeletal muscle tissue, U-87 MG cells, PC-12 cells
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17873-1-AP targets MMP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12359

Product name: Recombinant human MMP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-477 aa of BC074869

Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Predict reactive species
Full Name matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Calculated Molecular Weight 477 aa, 54 kDa
Observed Molecular Weight 45-60 kDa
GenBank Accession NumberBC074869
Gene Symbol MMP3
Gene ID (NCBI) 4314
RRIDAB_2146587
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08254
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot.

Protocols

Product Specific Protocols
IF protocol for MMP3 antibody 17873-1-APDownload protocol
WB protocol for MMP3 antibody 17873-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-MMP3 antibody (Cat# 17873-1-AP) has accumulated 348 citations published in high-impact journals including Nature Genetics, Nature Communications, Cell, Bioactive Materials, Bone Research, Advanced Science, Phytomedicine, International Immunopharmacology, Osteoarthritis and Cartilage, and Journal of Nanobiotechnology. Associated research fields encompass osteoarthritis, intervertebral disc degeneration, rheumatoid arthritis, cancer biology, ferroptosis, cellular senescence, inflammation, wound healing, diabetes, and stroke.

SpeciesApplicationTitle
mouseIF

Cell

Identifying specific functional roles for senescence across cell types

Authors - Huan Zhao
mouseIF

Nat Nanotechnol

A disease-severity-responsive nanoparticle enables potent ghrelin messenger RNA therapy in osteoarthritis.

Authors - Mahima Dewani

Exploration (Beijing)

Peptide RL-QN15 Regulates Functions of Epidermal Stem Cells to Accelerate Skin Wound Regeneration via the FZD8/β-Catenin Axis.

Authors - Yuansheng Li
ratWB,IF

Mil Med Res

D-mannose alleviates intervertebral disc degeneration through glutamine metabolism

Authors - Zheng-Lin Dong
humanWB

Nat Genet

Preneoplastic stromal cells promote BRCA1-mediated breast tumorigenesis

Authors - Kevin Nee
ratWB

Bioact Mater

Microenvironment-responsive metal-phenolic network release platform with ROS scavenging, anti-pyroptosis, and ECM regeneration for intervertebral disc degeneration

Authors - Hao Zhou

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 17873-1-AP is from Ana Luísa Castro (July 2022), who rated it 5 stars. She used it for immunofluorescence on intervertebral disc cells at a 1:100 dilution. Her protocol notes include 0.3% Triton X-100 for permeabilization and 2.5% BSA with 0.1% Triton X-100 for blocking. Overall, the reviewer had a positive experience with the product.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ana Luísa (Verified Customer) (07-25-2022)

Permeabilization: 0,3% Triton X-100 Blocking 2,5% BSA + 0,1% Triton X-100

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Intervertebral disc cells
Loading...
||
New chat

Able™

正在加载,请稍候...