• Featured Product
  • KD/KO Validated

MMP2 Polyclonal antibody

MMP2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10373-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (6)

Applications

WB, IHC, IF/ICC, IP, ELISA

Matrix metalloproteinase 2, Gelatinase A, EC:3.4.24.24, CLG4A, 72 kDa type IV collagenase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-1080 cells, MCF-7 cells, U-87 MG cells, HepG2 cells, U-251 cells, J774A.1 cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman gliomas tissue, human placenta tissue, human prostate cancer tissue, human heart tissue, human oesophagus tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

In sample preparation, the extracellular matrix needs to be included

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10373-2-AP targets MMP2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, rabbit, monkey, bovine, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0549

Product name: Recombinant human MMP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 461-660 aa of BC002576

Sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Predict reactive species
Full Name matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Calculated Molecular Weight 72 kDa
Observed Molecular Weight62-72 kDa
GenBank Accession NumberBC002576
Gene Symbol MMP2
Gene ID (NCBI) 4313
RRIDAB_2250823
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08253
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP2, also named as CLG4A, Gelatinase Am, TBE-1 and PEX, belongs to the peptidase M10A family. It is ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. MMP2 contributes to myocardial oxidative stress by regulating the activity of GSK3beta. It cleaves GSK3beta in vitro. MMP2 can be cleaved into PEX chain(~60kd). Western blot analysis showed that the 72 kDa and 62/65 kDa proteinase activities were pro-MMP2 and the active enzyme, respectively (PMID:11112697,PMID: 30867536).

Protocols

Product Specific Protocols
IHC protocol for MMP2 antibody 10373-2-APDownload protocol
IP protocol for MMP2 antibody 10373-2-APDownload protocol
WB protocol for MMP2 antibody 10373-2-APDownload protocol
IF protocol for MMP2 antibody 10373-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

J Thromb Haemost

Pharmacological reduction of coagulation factor XI reduces macrophage accumulation and accelerates deep vein thrombosis resolution in a mouse model of venous thrombosis.

Authors - Kelley R Jordan
mouseIHC

Cell Host Microbe

Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation

Authors - Zhenyu Tian
mouseWB

Circ Res

Unspliced XBP1 Confers VSMC Homeostasis and Prevents Aortic Aneurysm Formation via FoxO4 Interaction.

Authors - Guizhen Zhao
humanIHC

J Thorac Oncol

Silencing NKD2 by Promoter Region Hypermethylation Promotes Esophageal Cancer Progression by Activating Wnt Signaling.

Authors - Baoping Cao
WB

Small

M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation

Authors - Jie Sun
humanWB

Nat Commun

Cytoplasmic LIF reprograms invasive mode to enhance NPC dissemination through modulating YAP1-FAK/PXN signaling.

Authors - Shu-Chen Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christine (Verified Customer) (07-11-2022)

it doesn't seem that the antibody recognized anything specific on this blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:600
  • Cell Tissue Type: mouse macrophage cell line J774
MMP2 Antibody Western Blot validation (1:600 dilution) in mouse macrophage cell line J774 (Cat no:10373-2-AP)
FH

Hongxue (Verified Customer) (01-12-2021)

Not good for wb, lots of bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver
MMP2 Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:10373-2-AP)
FH

Kyosuke (Verified Customer) (06-12-2019)

I am working on aneurysm study and use this on mouse aneurysm sectioning for IHC. It works very well.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: aorta
FH

Lucy (Verified Customer) (03-08-2019)

Reacts to human MMP2 but not human MMP9

  • Applications: Western Blot,
MMP2 Antibody Western Blot, validation ( dilution) in (Cat no:10373-2-AP)
Loading...
||
New chat Able
正在加载,请稍候...