Neprilysin/CD10 Polyclonal antibody

• 

  WB analysis of mouse kidney using 18008-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18008-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 18008-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat kidney using 18008-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 18008-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Raji using 18008-1-AP

  IP result of anti-Neprilysin/CD10 (IP:18008-1-AP, 3ug; Detection:18008-1-AP 1:500) with Raji cells lysate 2400ug.

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18008-1-AP (MME,CD10 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human renal cell carcinoma using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human renal cell carcinoma using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 18008-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of human kidney using 18008-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human kidney using 18008-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using 18008-1-AP (Neprilysin/CD10 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Neprilysin/CD10 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 18008-1-AP

Publications(25)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

MME, MME,CD10, EPN, Enkephalinase, EC:3.4.24.11

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, human kidney tissue, rat kidney tissue
• Positive IP detected in: Raji cells
• Positive IHC detected in: human kidney tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 18 publications below
• IHC: See 6 publications below
• IF: See 3 publications below

Product Information

18008-1-AP targets Neprilysin/CD10 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12506

  Product name: Recombinant human MME,CD10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-80 aa of BC106070

  Sequence: MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA

• Full Name: membrane metallo-endopeptidase
• Calculated Molecular Weight: 80aa,9 kDa; 750aa,85 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC106070
• Gene Symbol: CD10
• Gene ID (NCBI): 4311
• RRID: AB_2146541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08473
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MME is also names as neprilysin,CALLA,NEP,SFE,CD10 and belongs to the peptidase M13 family.It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium.CD10 has been considered a useful marker in the diagnosis of renal carcinomas, because of its expression in clear cell and papillary renal cell carcinomas and its absence in chromophobe renal cell carcinomas(PMID:15286660).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Mater; Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment; Authors - Yuewen Zhai
mouse	WB	Adv Sci (Weinh); Bone Marrow-Derived GCA+ Immune Cells Drive Alzheimer's Disease Progression; Authors - Rui Zhou
human	WB	Brain; MMP13 inhibition rescues cognitive decline in Alzheimer transgenic mice via BACE1 regulation.; Authors - Bing-Lin Zhu
human,mouse	WB	Aging Cell; Microglia-derived Galectin-9 drives amyloid-β pathology in Alzheimer's disease; Authors - Guoxin Zhang
human	WB	Int J Biol Macromol; A novel pectin from Polygala tenuifolia blocks Aβ42 aggregation and production by enhancing insulin-degradation enzyme and neprilysin.; Authors - Hui Zeng
mouse	WB	Mol Neurobiol; Memantine, a Noncompetitive N-Methyl-D-Aspartate Receptor Antagonist, Attenuates Cerebral Amyloid Angiopathy by Increasing Insulin-Degrading Enzyme Expression.; Authors - Yasuteru Inoue

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (10-04-2021)

calculated size is 85 kd. This antibody recognized major bands at 60, 30 kd.

• Applications: Western Blot