MIA Polyclonal antibody

• 

  IHC staining of human skin cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin cancer using 15734-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15734-1-AP (MIA Antibody) at dilution of 1:50 (under 40x lens).

MIA Polyclonal Antibody for IHC, ELISA

Cat No. 15734-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

CD RAP, melanoma inhibitory activity, MIA

---

Tested Applications

• Positive IHC detected in: human skin cancer tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

15734-1-AP targets MIA in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8499

  Product name: Recombinant human MIA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-131 aa of BC005910

  Sequence: GGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

• Full Name: melanoma inhibitory activity
• Calculated Molecular Weight: 131 aa, 15 kDa
• GenBank Accession Number: BC005910
• Gene Symbol: MIA
• Gene ID (NCBI): 8190
• RRID: AB_2878176
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16674
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Melanoma-derived growth regulatory protein, also known as MIA, CD RAP, is a protein that in humans is encoded by the MIA gene. It is a marker for malignant melanoma (PMID: 9242442).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Clin Med; Melanoma Inhibitory Activity and Melanoma Inhibitory Activity 2 as Novel Immunohistochemical Markers of Oral Epithelial Dysplasia.; Authors - Ryoko Kawai