Use Able AI chat for product recommendations

MFN2 Recombinant monoclonal antibody

MFN2 Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF/ICC, ELISA

Cat No. 82673-2-RR
Clone No.2A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IHC-Autostainer, IF/ICC, ELISA

CPRP1, EC:3.6.5.-, HSG, KIAA0214, MARF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells
Positive IHC-Autostainer detected inHuman Small Bowel Tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82673-2-RR targets MFN2 in WB, IHC, IHC-Autostainer, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2845

Product name: Recombinant human MFN2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-353 aa of BC017061

Sequence: SLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSA

Predict reactive species
Full Name mitofusin 2
Calculated Molecular Weight 757 aa, 86 kDa
Observed Molecular Weight 86 kDa
GenBank Accession NumberBC017061
Gene Symbol MFN2
Gene ID (NCBI) 9927
ENSEMBL Gene IDENSG00000116688
RRIDAB_3086501
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95140
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitofusin-2 (MFN2), a mitochondrial membrane protein, is a dynamin-like GTPase embedded in the outer mitochondrial membrane (OMM) which plays a central role in regulating mitochondrial fusion and cell metabolism (PMID: 35399520; 34026850). There are two human mitofusin isoforms MFN1 and MFN2, MFN1 and MFN2 mediate outer membrane fusion, OPA1 is involved in inner membrane fusion, and DRP1 is responsible for mitochondrial fission (PMID: 17084350; 35399520). It has been shown that MFN2 participates in multiple cellular biological processes under physical and pathological conditions. Apart from mitochondria fusion, MFN2 is also involved in mitochondrial-ER contacts (MERCs), mitophagy, cellular apoptosis, and proliferation (PMID: 34026850).

Protocols

Product Specific Protocols
IF protocol for MFN2 antibody 82673-2-RRDownload protocol
IHC protocol for MFN2 antibody 82673-2-RRDownload protocol
WB protocol for MFN2 antibody 82673-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Cancer Lett

MFN2-CD36 interaction regulates mitochondrial lipid digestion in cancer-associated fibroblasts and promotes esophageal squamous cell carcinoma progression.

Authors - Xiao Shi
mouseWB

J Pharmacol Exp Ther

Alleviation of metabolic dysfunction-associated steatotic liver disease by silymarin is associated with maintaining mitochondrial homeostasis via regulation of optic atrophy 1.

Authors - Ming-Qiang Liu
mouseWB

J Ethnopharmacol

Senkyunolide a from danggui buxue decoction protects podocytes against diabetic nephropathy via the mir-223-3p/nlrp3 inflammasome axis.

Authors - Zhe Lv
Loading...
||
New chat

Able

正在加载,请稍候...