METTL1 Polyclonal antibody

• 

  WB analysis using 14994-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14994-1-AP (METTL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14994-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14994-1-AP (METTL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A2780 using 14994-1-AP

  IP result of anti-METTL1 (IP:14994-1-AP, 4ug; Detection:14994-1-AP 1:300) with A2780 cells lysate 3600 ug.

• 

  IHC staining of human liver cancer using 14994-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14994-1-AP (METTL1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 14994-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14994-1-AP (METTL1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

METTL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14994-1-AP

Publications(29)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Synonyms

miRNA, Methyltransferase-like protein 1, methyltransferase like 1, EC:2.1.1.33, EC:2.1.1.-

---

Tested Applications

• Positive WB detected in: A549 cells, HuH-7 cells, HeLa cells, rat brain tissue, mouse brain tissue
• Positive IP detected in: A2780 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 18 publications below
• WB: See 23 publications below
• IHC: See 11 publications below
• IF: See 3 publications below
• RIP: See 1 publications below

Product Information

14994-1-AP targets METTL1 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6980

  Product name: Recombinant human METTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC000550

  Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH

• Full Name: methyltransferase like 1
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC000550
• Gene Symbol: METTL1
• Gene ID (NCBI): 4234
• RRID: AB_2142013
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBP6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL1 methyltransferase mediates m7G methylation within miRNAs and regulates cell migration via its catalytic activity. METTL1 can be inactivated by phosphorylation at Ser27 by protein kinase B (PKBα). Overexpression of METTL1 is widely observed among human cancers. It is also crucial for the regulation of chemoresistance in cancer treatment. In addition, mutations in the human N7-methylguanosine (m7G) methyltransferase complex METTL1/WDR4 cause primordial dwarfism and brain malformation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Structural basis of regulated m7G tRNA modification by METTL1-WDR4; Authors - Jiazhi Li ; KO Validated
human	WB	Cell Res; Dynamic methylome of internal mRNA N7-methylguanosine and its regulatory role in translation.; Authors - Lionel Malbec
human,mouse	WB	Mol Cell; A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation; Authors - Raja H Ali ; KD Validated
human,mouse	WB,IHC	Mol Cell; N7-Methylguanosine tRNA modification enhances oncogenic mRNA translation and promotes intrahepatic cholangiocarcinoma progression.; Authors - Zihao Dai ; KD Validated
human,mouse	WB	Mol Cell; METTL1-mediated m7G modification of Arg-TCT tRNA drives oncogenic transformation.; Authors - Esteban A Orellana ; KD Validated
mouse		Mol Cell; Mettl1/Wdr4-Mediated m7G tRNA Methylome Is Required for Normal mRNA Translation and Embryonic Stem Cell Self-Renewal and Differentiation.; Authors - Shuibin Lin ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Zhongwen (Verified Customer) (09-25-2023)

Clear band.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293T

METTL1 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:14994-1-AP)

FH

Hannah (Verified Customer) (12-05-2018)

Single specific band detected at expected size after overnight primary incubation.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: human fibroblast

METTL1 Antibody Western Blot, validation (1/1000 dilution) in human fibroblast (Cat no:14994-1-AP)