Tested Applications
| Positive WB detected in | HepG2 cells, HL-60 cells, HEK-293 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human renal cell carcinoma tissue, human liver cancer tissue, rat heart tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15904-1-AP targets MDH1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8744 Product name: Recombinant human MDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-334 aa of BC001484 Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA Predict reactive species |
| Full Name | malate dehydrogenase 1, NAD (soluble) |
| Calculated Molecular Weight | 334 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC001484 |
| Gene Symbol | MDH1 |
| Gene ID (NCBI) | 4190 |
| RRID | AB_2143279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40925 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme.(PMID:10693743)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MDH1 antibody 15904-1-AP | Download protocol |
| IF protocol for MDH1 antibody 15904-1-AP | Download protocol |
| IHC protocol for MDH1 antibody 15904-1-AP | Download protocol |
| IP protocol for MDH1 antibody 15904-1-AP | Download protocol |
| WB protocol for MDH1 antibody 15904-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
MDH1 Antibody (Cat# 15904-1-AP) has 37 citations published in journals including Cell, Cell Research, Blood, Nature Communications, Molecular Cell, eLife, EMBO Journal, Cell Reports, iScience, and PLoS Pathogens. Research fields span cancer metabolism, mitochondrial function, aspartate synthesis, ferroptosis, pyroptosis, liver disease, immune metabolism, protein post-translational modifications, diabetes, reproductive biology, and virology.
| Species | Application | Title |
|---|---|---|
Cell An Essential Role of the Mitochondrial Electron Transport Chain in Cell Proliferation Is to Enable Aspartate Synthesis.
| ||
Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. | ||
Cell Res The metabolite α-KG induces GSDMC-dependent pyroptosis through death receptor 6-activated caspase-8. | ||
Blood MDH1-mediated malate-aspartate NADH shuttle maintains the activity levels of fetal liver hematopoietic stem cells. | ||
Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. |
