MCL1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• MCL1 Monoclonal antibody (66026-1-Ig)

• Featured Product
• KD/KO Validated

MCL1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66026-1-Ig Copied!

Clone No. 1E3C2

Publications (25)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

Synonyms

1E3C2, Bcl2-L-3, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT

• 

  WB analysis using 66026-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66026-1-Ig

  WB result of MCL1 antibody (66026-1-Ig, 1:1000) with si-Control and si-MCL1 transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66026-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 66026-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66026-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 66026-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 66026-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 66026-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66026-1-Ig (MCL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66026-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66026-1-Ig (MCL1 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66026-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66026-1-Ig (MCL1 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66026-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MCL1 antibody (66026-1-Ig, Clone: 1E3C2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66026-1-Ig

  Immunofluorescent analysis of Hela cells, using MCL1 antibody 66026-1-lg at 1:25 dilution and Rhodamine-labeled goat anti-mouse IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 66026-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 66026-1-Ig (MCL1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 66026-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 66026-1-Ig against Human MCL1 was performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MCL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, A549 cells, Jurkat cells, Raji cells, Ramos cells, Daudi cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66026-1-Ig targets MCL1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, hamster
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10609

  Product name: Recombinant human MCL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-327 aa of BC107735

  Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

• Full Name: myeloid cell leukemia sequence 1 (BCL2-related)
• Calculated Molecular Weight: 350 aa, 37 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC107735
• Gene Symbol: MCL1
• Gene ID (NCBI): 4170
• RRID: AB_11041711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07820
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target.

Publications

What published studies show

Anti-MCL1 antibody (Cat# 66026-1-Ig) has accumulated 25 citations across journals including Redox Biology, Cell Death & Differentiation, Cell Reports, British Journal of Pharmacology, International Journal of Molecular Sciences, Scientific Reports, and Oncology Reports. Associated research fields encompass apoptosis regulation, cancer biology (pancreatic, lung, liver, ovarian, breast, melanoma, leukemia, lymphoma), cardiac hypertrophy, ferroptosis, endometriosis, placenta accreta, lupus nephritis, and diabetic cataract.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Redox Biol; Tectorigenin attenuates cardiac hypertrophy via USP9X/MCL1-mediated mitochondrial stabilization; Authors - Xiaoqiang Chen ; KD Validated
human	WB	Cell Death Differ; Phosphorylation-dependent STAMBP drives the progression of pancreatic ductal adenocarcinoma by deubiquitinating and stabilizing BAG3.; Authors - Yongkang Shi
human	WB,IP,CoIP	Cell Rep; Targeting MCL-1 triggers DNA damage and an anti-proliferative response independent from apoptosis induction; Authors - Utsarga Adhikary
mouse	WB	Br J Pharmacol; Induction of IL-9-producing CD8(+) T cells by ascochlorin derivatives.; Authors - Natsumi Imano
human	WB	Chin Med; Sanguinarine chloride induces ferroptosis by regulating ROS/BACH1/HMOX1 signaling pathway in prostate cancer; Authors - Shanhui Liu
human	WB	Int J Mol Sci; Targeting EZH2 Promotes Chemosensitivity of BCL-2 Inhibitor through Suppressing PI3K and c-KIT Signaling in Acute Myeloid Leukemia; Authors - Chan Yang