LYVE1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LYVE1 Polyclonal antibody (28321-1-AP)

LYVE1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28321-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Cell surface retention sequence-binding protein 1, CRSBP 1, CRSBP1, CRSBP-1, Extracellular link domain-containing protein 1

• 

  WB analysis using 28321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28321-1-AP (LYVE1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 28321-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28321-1-AP (LYVE1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 28321-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 28321-1-AP (LYVE1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat liver using 28321-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using LYVE1 antibody (28321-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LYVE1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HUVEC cells, bEnd.3 cells, mouse heart tissue, mouse liver tissue, rat heart tissue, rat liver tissue
• Positive IHC detected in: rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28321-1-AP targets LYVE1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28131

  Product name: Recombinant human LYVE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-322 aa of BC026231

  Sequence: SIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV

• Full Name: lymphatic vessel endothelial hyaluronan receptor 1
• Calculated Molecular Weight: 322 aa, 35 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC026231
• Gene Symbol: LYVE1
• Gene ID (NCBI): 10894
• RRID: AB_3086043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Y7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Publications

What published studies show

The LYVE1 Polyclonal antibody (Cat# 28321-1-AP) has 11 citations spanning journals including Nature Communications, Journal of Advanced Research, Aging Cell, Frontiers in Immunology, International Immunopharmacology, Cell Signaling, Experimental Eye Research, Discovery Oncology, Neuroscience Letters, Surgical and Radiologic Anatomy, and Frontiers in Physiology. Research fields cover lymphatic vessel biology, ischemic stroke, macrophage senescence, meningeal lymphatic dysfunction, corneal lymphangiogenesis, lung cancer metastasis, and brain lymphatic drainage.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Nat Commun; Lymph nodes molecular subtypes unravel lymph nodes heterogeneity and clinical implications in colorectal cancer; Authors - Xu Guan
mouse	WB	J Adv Res; Aquaporin 4 and its isoforms regulation ameliorate AQP4 Mis-localization-induced glymphatic dysfunction in ischemic stroke; Authors - Hanhong Zhang
		Aging Cell; Senescent Macrophages Promote Age-Related Revascularization Impairment by Increasing Antiangiogenic VEGF-A165B Expression; Authors - Minghong Chen
mouse	IF	Front Immunol; Meningeal lymphatic vessel dysfunction exacerbates brain injury in CVST mice via endoplasmic reticulum and oxidative stress pathways.; Authors - Jianbin Ying
mouse	WB,IF	Int Immunopharmacol; Targeting IL-1β to inhibit neutrophil extracellular traps improves meningeal lymphatic dysfunction in cerebral venous sinus thrombosis.; Authors - Jun Li
		Cell Signal; Effect of the BMP4-Smad pathway on corneal immune double-arm and mechanism study.; Authors - Yuxiao Guo