Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Cytokeratin 14 Polyclonal antibody

Cytokeratin 14 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

KRT14, CK 14, CK14, CK-14, Cytokeratin,Keratin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Cytokeratin 14 in ?

Tested Applications

Positive WB detected inA431 cells, rat skin tissue
Positive IP detected inA431 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human cervical cancer tissue, mouse skin tissue, rat skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHaCaT cells, HeLa cells, HepG2 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10143-1-AP targets Cytokeratin 14 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0188

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-472 aa of BC002690

Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight 47-50 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_2134831
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02533
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Protocols

Product Specific Protocols
FC protocol for Cytokeratin 14 antibody 10143-1-APDownload protocol
IF protocol for Cytokeratin 14 antibody 10143-1-APDownload protocol
IHC protocol for Cytokeratin 14 antibody 10143-1-APDownload protocol
IP protocol for Cytokeratin 14 antibody 10143-1-APDownload protocol
WB protocol for Cytokeratin 14 antibody 10143-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Cytokeratin 14 (KRT14) Polyclonal Antibody (Cat# 10143-1-AP) has 132 total citations. Publications appear in high-impact journals including Nature Communications, Cell Stem Cell, Biomaterials, Advanced Healthcare Materials, Acta Biomaterialia, Cell Death & Disease, Oncogene, and Journal of Investigative Dermatology. Research fields span wound healing, epidermal stem cell biology, psoriasis, olfactory epithelium regeneration, corneal epithelium homeostasis, skin aging, hair follicle biology, and oncology including bladder, breast, and nasopharyngeal cancers.

SpeciesApplicationTitle

Exploration (Beijing)

Peptide RL-QN15 Regulates Functions of Epidermal Stem Cells to Accelerate Skin Wound Regeneration via the FZD8/β-Catenin Axis.

Authors - Yuansheng Li
humanIF

Bioact Mater

Biomimetic gender-specific human skin model based on gonads/epidermis-on-a-chip

Authors - Xiangyi Wu
mouseIHC

Cell Stem Cell

Injury Induces Endogenous Reprogramming and Dedifferentiation of Neuronal Progenitors to Multipotency.

Authors - Brian Lin
humanIF

Nat Commun

Human induced pluripotent stem cell-derived vocal fold mucosa mimics development and responses to smoke exposure.

Authors - Vlasta Lungova
humanIF

Nat Commun

Living sensor display implanted on skin for long-term biomarker monitoring.

Authors - Jun Sawayama
mouseIF

Nat Commun

Malfunction of airway basal stem cells plays a crucial role in pathophysiology of tracheobronchopathia osteoplastica.

Authors - Yue Hong

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

Users consistently rate this antibody highly (average 4.75/5). It performs well across multiple applications including IHC, Western blot, and immunofluorescence. Recommended dilutions range from 1:100 to 1:500 depending on the application. Reviewers report bright, specific staining in human lung cancer tissue, MCF10A cells, prostate basal cells, and human keratinocytes. One user noted it works particularly well with pH9 TE buffer for IHC DAB staining. Overall, customers express satisfaction and intent to repurchase.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Nikolett (Verified Customer) (03-31-2026)

This antibody is ideal to human lung cancer tissue as a 1:100 dilution, utilized for IHC DAB staining with pH9 TE buffer.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human lung cancer tissue

Rachel (Verified Customer) (03-19-2024)

Excellent antibody, got the tester but will be purchasing more for future work.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: MCF10A
Cytokeratin 14 Antibody Western Blot,Immunofluorescence validation (1:200 dilution) in MCF10A (Cat no:10143-1-AP)

Parmveer (Verified Customer) (10-20-2019)

Worked well to detect basal cells around the prostate gland of formalin fixed tissue

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Prostate
Cytokeratin 14 Antibody Immunofluorescence, validation (1:400 dilution) in Prostate (Cat no:10143-1-AP)

Joshua (Verified Customer) (05-10-2019)

Human Keratinocytes fixed in 4% paraformaldehyde and stained for KRT14. Goat anti-rabbit 488. Bright, specific staining observed.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human Keratinocytes
Cytokeratin 14 Antibody Immunofluorescence, validation (1:500 dilution) in Human Keratinocytes (Cat no:10143-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...