Kallikrein 8 Polyclonal antibody

• 

  WB analysis of HeLa using 14232-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14232-1-AP (Kallikrein 8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 14232-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 14232-1-AP (Kallikrein 8 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Kallikrein 8 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14232-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KLK8, KLK 8, Kallikrein-8, Kallikrein8, kallikrein related peptidase 8

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14232-1-AP targets Kallikrein 8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5472

  Product name: Recombinant human KLK8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-260 aa of BC040887

  Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

• Full Name: kallikrein-related peptidase 8
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC040887
• Gene Symbol: KLK8
• Gene ID (NCBI): 11202
• RRID: AB_2134643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60259
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK8(Kallikrein-8) is also named as NRPN, PRSS19, TADG14.It is a new member of the human kallikrein family, which is predicted to be secreted and expected to be present in biological fluids (PMID:12507964).The protein is detectable in ovarian cancer tissue extracts, serum, and ascites fluid, indicating that it may serve as a new ovarian cancer marker (PMID:12782581). KLK8 has one predicted glycosylation site (PMID:20940292) and it has some isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; EZH2-dependent epigenetic modulation of histone H3 lysine-27 contributes to psoriasis by promoting keratinocyte proliferation.; Authors - Tongmei Zhang