KIF7 Polyclonal antibody

• 

  WB analysis of HEK-293 using 24693-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24693-1-AP (KIF7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24693-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24693-1-AP (KIF7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 24693-1-AP

  IP result of anti-KIF7 (IP:24693-1-AP, 5ug; Detection:24693-1-AP 1:500) with HEK-293 cells lysate 1760ug.

• Featured Product
• KD/KO Validated

KIF7 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24693-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KIF7, kinesin family member 7, Kinesin like protein KIF7, UNQ340

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

24693-1-AP targets KIF7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19119

  Product name: Recombinant human KIF7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1214-1332 aa of BC112271

  Sequence: VNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGPLSKPRRELRRAS

• Full Name: kinesin family member 7
• Calculated Molecular Weight: 1343 aa, 151 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC112271
• Gene Symbol: KIF7
• Gene ID (NCBI): 374654
• RRID: AB_2879677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2M1P5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIF7(Kinesin family member 7) is a microtubule interacting protein that functions to regulate Hh signaling by maintaining the architecture of the primary cilium, a complex microtubule-based organelle with many signal transduction functions (PMID: 26439735). KIF7 has been shown to have both negative and positive roles in Shh signal transduction. Without a ligand, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components and promotes the processing of GliRs (PMID: 21552264).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Sci Adv; Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ.; Authors - Chuan Chen
human	WB	Cells; Determination of WWOX Function in Modulating Cellular Pathways Activated by AP-2α and AP-2γ Transcription Factors in Bladder Cancer.; Authors - Damian Kołat
human	WB	Thorac Cancer; Human papillomavirus 16 (HPV 16) E6 but not E7 inhibits the antitumor activity of LKB1 in lung cancer cells by downregulating the expression of KIF7.; Authors - Yue Hu ; KD Validated
human	WB,IHC	Cell Death Dis; Circular RNA circUBE2J2 acts as the sponge of microRNA-370-5P to suppress hepatocellular carcinoma progression.; Authors - Lu Zhang
human	WB	Proteome Sci; Proteomics identifies differentially expressed proteins in glioblastoma U87 cells treated with hederagenin; Authors - Yesen Zhang
mouse,human	WB,IF	Leukemia; P4HA2 hydroxylates SUFU to regulate the paracrine Hedgehog signaling and promote B-cell lymphoma progression; Authors - Quanfu Li