Tested Applications
| Positive WB detected in | Caco-2 cells, HeLa cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
15911-1-AP targets KIF20A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8700 Product name: Recombinant human KIF20A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC012999 Sequence: MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQD Predict reactive species |
| Full Name | kinesin family member 20A |
| Calculated Molecular Weight | 890 aa, 100 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC012999 |
| Gene Symbol | KIF20A |
| Gene ID (NCBI) | 10112 |
| RRID | AB_2131434 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95235 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KIF20A, also known as RAB6KIFL or MKlp2, is a kinesin originally identified as a binding partner for the rab6 GTPase involved in protein transport at the Golgi apparatus. KIF20A belongs to a large family of motor proteins that accumulate in mitotic cells and is required for normal cell division. KIF20A is thought to be involved in carcinogenesis. In normal tissues KIF20A is almost undetectable while it is overexpressed in various cancers. KIF20A has been identified as a novel promising candidate for anticancer immunotherapy.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF20A antibody 15911-1-AP | Download protocol |
| IHC protocol for KIF20A antibody 15911-1-AP | Download protocol |
| IP protocol for KIF20A antibody 15911-1-AP | Download protocol |
| WB protocol for KIF20A antibody 15911-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Coupling fission and exit of RAB6 vesicles at Golgi hotspots through kinesin-myosin interactions. | ||
Cancer Lett Inhibition of KIF20A enhances the immunotherapeutic effect of hepatocellular carcinoma by enhancing c-Myc ubiquitination | ||
J Ginseng Res Ginsenoside 20(S)-Rg3 reduces KIF20A expression and promotes CDC25A proteasomal degradation in epithelial ovarian cancer | ||
Proteomics Genistein-induced mitotic arrest of gastric cancer cells by downregulating KIF20A, a proteomics study. | ||
J Cancer Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma. | ||
J Biochem Mol Toxicol Bisphenol A triggers the malignancy of acute myeloid leukemia cells via regulation of IL-4 and IL-6. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (04-03-2024) | Not suitable for IF at all. showed many blobs staining all over the field, and cannot label any Golgi staining.
|
FH Juliane (Verified Customer) (10-25-2022) | Golgi and nucleus staining ok but cytoplasmic difficult
![]() |














