JAM2 Polyclonal antibody

• 

  WB analysis of human placenta using 12972-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12972-1-AP (JAM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 12972-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12972-1-AP (JAM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

JAM2 Polyclonal Antibody for WB, ELISA

Cat No. 12972-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C21orf43, CD322, JAM-2, JAMB, JAM-B

---

Tested Applications

• Positive WB detected in: human placenta tissue, human heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

12972-1-AP targets JAM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3431

  Product name: Recombinant human JAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-298 aa of BC017779

  Sequence: MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

• Full Name: junctional adhesion molecule 2
• Calculated Molecular Weight: 298 aa, 33 kDa
• Observed Molecular Weight: 33 kDa, 43 kDa
• GenBank Accession Number: BC017779
• Gene Symbol: JAM2
• Gene ID (NCBI): 58494
• RRID: AB_10638910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57087
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Junctional adhesion molecules (JAMs) are integral membrane proteins belonging to the immunoglobulin (Ig) superfamily. JAMs are expressed by leukocytes, platelets, endothelial, and epithelial cells and localized at the tight junction of polarized cells and on the cell surface of leukocytes. JAM-2, also known as VE-JAM or JAM-B, is specifically expressed in lymphatic endothelial cells and endothelial venules. JAM2 regulates cell-cell adhesion and signaling by interacting with other tight junction proteins such as PAR-3 and ZO-1.(PMID: 14657270; PMID: 24595739; PMID: 11739175; PMID: 12953056)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Microbiol; Porphyromonas gingivalis induces penetration of lipopolysaccharide and peptidoglycan through the gingival epithelium via degradation of coxsackievirus and adenovirus receptor.; Authors - Hiroki Takeuchi
mouse	WB	Diabetes Res Clin Pract; Heparanase-driven inflammation from the AGEs-stimulated macrophages changes the functions of glomerular endothelial cells.; Authors - Guang Xu
rat	WB	Mol Cell Endocrinol; PPM1G dephosphorylates α-catenin to maintain the integrity of adherens junctions and regulates apoptosis in Sertoli cells; Authors - Xinyao Li