Tested Applications
| Positive WB detected in | mouse spleen tissue, Jurkat cells, rat spleen tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23457-1-AP targets CD126/IL-6R alpha in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18263 Product name: Recombinant human IL-6R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-371 aa of BC132684 Sequence: PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG Predict reactive species |
| Full Name | interleukin 6 receptor |
| Calculated Molecular Weight | 468 aa, 52 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC132684 |
| Gene Symbol | IL-6R alpha |
| Gene ID (NCBI) | 3570 |
| RRID | AB_2827428 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08887 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| IP protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| WB protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-IL-6R antibody (Cat# 23457-1-AP) has accumulated 64 citations published in high-impact journals including Signal Transduction and Targeted Therapy, Nature Nanotechnology, Nature Communications, Nature Aging, Cancer Discovery, Cell Reports, Journal of Biological Chemistry, and Journal of Ethnopharmacology. Associated research fields span inflammation and macrophage polarization, oncology (lung, breast, pancreatic, glioblastoma, melanoma), neurology (stroke, spinal cord injury, neuropathy), cardiovascular disease (atherosclerosis, myocardial infarction), rheumatoid arthritis, gastroenterology (colitis), immunology, reproductive biology, kidney disease, and aging/fibrosis.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Targeting polarized phenotype of microglia via IL6/JAK2/STAT3 signaling to reduce NSCLC brain metastasis. | ||
Signal Transduct Target Ther Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms | ||
Nat Nanotechnol A bispecific nanosystem activates endogenous natural killer cells in the bone marrow for haematologic malignancies therapy | ||
Cancer Discov Loss of Optineurin Drives Cancer Immune Evasion via Palmitoylation-Dependent IFNGR1 Lysosomal Sorting and Degradation. | ||
Nat Aging A chimeric peptide promotes immune surveillance of senescent cells in injury, fibrosis, tumorigenesis and aging | ||
Nat Commun Targeted therapies of inflammatory diseases with intracellularly gelated macrophages in mice and rats |
Reviews
What customers say
One user rated this product 5 stars, reporting that it works very well for Western Blot. The reviewer used a 1:1000 dilution on human T-cells and was satisfied with the performance. Overall, the feedback is positive, with the sole review highlighting reliable WB results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jianhua (Verified Customer) (04-02-2025) | works very well for western blot
|
